Os03t0168700-00

Locus

Os03g0168700

Description

SET domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET14, SDG739

Oryzabase Gene Name Synonym(s)

SET protein 14

Transcript Evidence

ab initio prediction

Protein Evidence

NP_001049093.1 (RefSeq)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: binding (GO:0005488)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

SET domain (IPR001214)

Tetratricopeptide-like helical (IPR011990)

Tetratricopeptide repeat-containing (IPR013026)

Expression Databases

TENOR (Os03t0168700-00)

Others

Oryzabase (13380)

Transcript

1611 bp

>Os03t0168700-00 SET domain containing protein.
ATGGCGACGCCCGGCCTCGACGACGACTCGCTGCAGCAGCTGCGCAGCCGCGCGACGCAG
CTGCTGCTCAAGGAGAACTGGACGGAGTACATCGCCGTGTGCTCCCTCATCATCGAGGCG
TTCGACGCCGCCGCCGCCTGCAAAGACCGCCGCGTCCTCTGCTCCACCCTCGCCCACCGC
GCCGACGCCCGCGCCCGCCTCGGCGACGCCCCCGGCGCGCTCGCCGACTGCGACGCCGCG
CTGGCGGCCGACCCGGCGCACCCCGGGGCGTTGCTGTCCAAGGGCGCCGTCCTGCGCGGC
CTCGGCCGGTACTCGCGCGCCGCCGAGTGCTTCCGCGCGGCGCTCGCCGTGAGCGGCACC
GACGAGGTCCGGGAGATGGTCGAGCAGTGTAAGCGCCTGGACGCGCAGGCGAGGAGCGGC
GCGGTGGATCTGTCGGAGTGGGTGCTCGCCGGGTTCTCCGGGAAGTGCCCAGACCTCGCG
GAGCACGTCGGGGCGGTGGAGGTGCGCCGGTCCGCGCACGGCGGCCGAGGGGTGTTCGCG
GTGAAGAACATCGAGGCGGGAGCTAACCTGGTGATCTCCAAGGCGGTGGCGATCGGAAGG
GGAGTAATTCCGGACGCCGCCGATAGCGGCGAGAAGATGGTGGTGTGGAAGGACCTCGTC
GACAAGGTGCTCGACGCCGCCGAGAAGTGCCCGAGGACGGCATCTCTCATCTACACTCTC
TCCACCGGCGAGGAGCCAGAAGACGAGCTCCCCATCCCGGACATGGCACATTTCAAGCAA
GAAACGGAGGAGCTCGATGACGGCACGGCCATGGCGCCGAAGGCATCTCTTGATGTGGAC
AAGATCTTGAAAGTGCTCGACGTCAATTGCTTGACCGAGGACGCAGCGCCATCCGCCAAT
CTGCTCGGCAGCAATGGCGTCGTCAACTGCGGCGTCGGGCTGTGGATCTTGCCGGCGTTC
ATCAACCACTCGTGCCACCCCAACGCCCGGCGCACCCACGTCGGCGACCACGCCATTGTC
CACGCGTCAAGGGACATCAAAGCCGGGGAGGAGATCACATTCGCCTACTTCGACGTGCTC
ACCCCGGCGAGCAAGCGCAGGGAGGCAGCGAGAGCGTGGGGCCTCGAATGCCAATGCGAT
CGGTGCAGGTTCGAAGCCAGCGACGCCATTGTTGGGCAAGAACTCACAAAACTTGAGAAC
GAATTGGTCAATGGCCGAGGAGGAGACATGGGAGCACTGGTGGTGAGGCTGGAGGAGAGG
ATGAGAAAGTCCATGGTGAAGGAGAGGAGGAAGGCGTTCTTGCGCGCGTCGTTCTGGAGC
GCGTACTCCGCGCTGTTCGACTCCGACAAGCTGGTGAGGAAGTGGGGGAGGCGCGTCCCC
GGTGAGGCCGCCGTCGCAGAGAGCGTCGCCGGCGCAATCGGCGGGAACGAGAGCGTGCTG
AGGGCAATGCTGAGGGGTGCCGACAATGGCAACGGCTGCGGCAATCGGCTCGAGGTGGAA
GACAAGGTGGTGAGGATTGGGAGGGCTACCTATGGCAGGGTAGTGAAGAGGCAGGCAATG
AGAGCTCTCTTCAGACTTACATTGGATGCTGACAGTAACAAAAGCCTGTAG

CDS

1611 bp

>Os03t0168700-00 SET domain containing protein.
ATGGCGACGCCCGGCCTCGACGACGACTCGCTGCAGCAGCTGCGCAGCCGCGCGACGCAG
CTGCTGCTCAAGGAGAACTGGACGGAGTACATCGCCGTGTGCTCCCTCATCATCGAGGCG
TTCGACGCCGCCGCCGCCTGCAAAGACCGCCGCGTCCTCTGCTCCACCCTCGCCCACCGC
GCCGACGCCCGCGCCCGCCTCGGCGACGCCCCCGGCGCGCTCGCCGACTGCGACGCCGCG
CTGGCGGCCGACCCGGCGCACCCCGGGGCGTTGCTGTCCAAGGGCGCCGTCCTGCGCGGC
CTCGGCCGGTACTCGCGCGCCGCCGAGTGCTTCCGCGCGGCGCTCGCCGTGAGCGGCACC
GACGAGGTCCGGGAGATGGTCGAGCAGTGTAAGCGCCTGGACGCGCAGGCGAGGAGCGGC
GCGGTGGATCTGTCGGAGTGGGTGCTCGCCGGGTTCTCCGGGAAGTGCCCAGACCTCGCG
GAGCACGTCGGGGCGGTGGAGGTGCGCCGGTCCGCGCACGGCGGCCGAGGGGTGTTCGCG
GTGAAGAACATCGAGGCGGGAGCTAACCTGGTGATCTCCAAGGCGGTGGCGATCGGAAGG
GGAGTAATTCCGGACGCCGCCGATAGCGGCGAGAAGATGGTGGTGTGGAAGGACCTCGTC
GACAAGGTGCTCGACGCCGCCGAGAAGTGCCCGAGGACGGCATCTCTCATCTACACTCTC
TCCACCGGCGAGGAGCCAGAAGACGAGCTCCCCATCCCGGACATGGCACATTTCAAGCAA
GAAACGGAGGAGCTCGATGACGGCACGGCCATGGCGCCGAAGGCATCTCTTGATGTGGAC
AAGATCTTGAAAGTGCTCGACGTCAATTGCTTGACCGAGGACGCAGCGCCATCCGCCAAT
CTGCTCGGCAGCAATGGCGTCGTCAACTGCGGCGTCGGGCTGTGGATCTTGCCGGCGTTC
ATCAACCACTCGTGCCACCCCAACGCCCGGCGCACCCACGTCGGCGACCACGCCATTGTC
CACGCGTCAAGGGACATCAAAGCCGGGGAGGAGATCACATTCGCCTACTTCGACGTGCTC
ACCCCGGCGAGCAAGCGCAGGGAGGCAGCGAGAGCGTGGGGCCTCGAATGCCAATGCGAT
CGGTGCAGGTTCGAAGCCAGCGACGCCATTGTTGGGCAAGAACTCACAAAACTTGAGAAC
GAATTGGTCAATGGCCGAGGAGGAGACATGGGAGCACTGGTGGTGAGGCTGGAGGAGAGG
ATGAGAAAGTCCATGGTGAAGGAGAGGAGGAAGGCGTTCTTGCGCGCGTCGTTCTGGAGC
GCGTACTCCGCGCTGTTCGACTCCGACAAGCTGGTGAGGAAGTGGGGGAGGCGCGTCCCC
GGTGAGGCCGCCGTCGCAGAGAGCGTCGCCGGCGCAATCGGCGGGAACGAGAGCGTGCTG
AGGGCAATGCTGAGGGGTGCCGACAATGGCAACGGCTGCGGCAATCGGCTCGAGGTGGAA
GACAAGGTGGTGAGGATTGGGAGGGCTACCTATGGCAGGGTAGTGAAGAGGCAGGCAATG
AGAGCTCTCTTCAGACTTACATTGGATGCTGACAGTAACAAAAGCCTGTAG

Protein

537 aa

>Os03t0168700-00 SET domain containing protein.
MATPGLDDDSLQQLRSRATQLLLKENWTEYIAVCSLIIEAFDAAAACKDRRVLCSTLAHR
ADARARLGDAPGALADCDAALAADPAHPGALLSKGAVLRGLGRYSRAAECFRAALAVSGT
DEVREMVEQCKRLDAQARSGAVDLSEWVLAGFSGKCPDLAEHVGAVEVRRSAHGGRGVFA
VKNIEAGANLVISKAVAIGRGVIPDAADSGEKMVVWKDLVDKVLDAAEKCPRTASLIYTL
STGEEPEDELPIPDMAHFKQETEELDDGTAMAPKASLDVDKILKVLDVNCLTEDAAPSAN
LLGSNGVVNCGVGLWILPAFINHSCHPNARRTHVGDHAIVHASRDIKAGEEITFAYFDVL
TPASKRREAARAWGLECQCDRCRFEASDAIVGQELTKLENELVNGRGGDMGALVVRLEER
MRKSMVKERRKAFLRASFWSAYSALFDSDKLVRKWGRRVPGEAAVAESVAGAIGGNESVL
RAMLRGADNGNGCGNRLEVEDKVVRIGRATYGRVVKRQAMRALFRLTLDADSNKSL*

CDS

chr03:3705167..3706777 (- strand) : 1611 bp

FASTA

>Os03t0168700-00 class=Sequence position=chr03:3705167..3706777 (- strand)
ATGGCGACGC CCGGCCTCGA CGACGACTCG CTGCAGCAGC TGCGCAGCCG CGCGACGCAG CTGCTGCTCA AGGAGAACTG
GACGGAGTAC ATCGCCGTGT GCTCCCTCAT CATCGAGGCG TTCGACGCCG CCGCCGCCTG CAAAGACCGC CGCGTCCTCT
GCTCCACCCT CGCCCACCGC GCCGACGCCC GCGCCCGCCT CGGCGACGCC CCCGGCGCGC TCGCCGACTG CGACGCCGCG
CTGGCGGCCG ACCCGGCGCA CCCCGGGGCG TTGCTGTCCA AGGGCGCCGT CCTGCGCGGC CTCGGCCGGT ACTCGCGCGC
CGCCGAGTGC TTCCGCGCGG CGCTCGCCGT GAGCGGCACC GACGAGGTCC GGGAGATGGT CGAGCAGTGT AAGCGCCTGG
ACGCGCAGGC GAGGAGCGGC GCGGTGGATC TGTCGGAGTG GGTGCTCGCC GGGTTCTCCG GGAAGTGCCC AGACCTCGCG
GAGCACGTCG GGGCGGTGGA GGTGCGCCGG TCCGCGCACG GCGGCCGAGG GGTGTTCGCG GTGAAGAACA TCGAGGCGGG
AGCTAACCTG GTGATCTCCA AGGCGGTGGC GATCGGAAGG GGAGTAATTC CGGACGCCGC CGATAGCGGC GAGAAGATGG
TGGTGTGGAA GGACCTCGTC GACAAGGTGC TCGACGCCGC CGAGAAGTGC CCGAGGACGG CATCTCTCAT CTACACTCTC
TCCACCGGCG AGGAGCCAGA AGACGAGCTC CCCATCCCGG ACATGGCACA TTTCAAGCAA GAAACGGAGG AGCTCGATGA
CGGCACGGCC ATGGCGCCGA AGGCATCTCT TGATGTGGAC AAGATCTTGA AAGTGCTCGA CGTCAATTGC TTGACCGAGG
ACGCAGCGCC ATCCGCCAAT CTGCTCGGCA GCAATGGCGT CGTCAACTGC GGCGTCGGGC TGTGGATCTT GCCGGCGTTC
ATCAACCACT CGTGCCACCC CAACGCCCGG CGCACCCACG TCGGCGACCA CGCCATTGTC CACGCGTCAA GGGACATCAA
AGCCGGGGAG GAGATCACAT TCGCCTACTT CGACGTGCTC ACCCCGGCGA GCAAGCGCAG GGAGGCAGCG AGAGCGTGGG
GCCTCGAATG CCAATGCGAT CGGTGCAGGT TCGAAGCCAG CGACGCCATT GTTGGGCAAG AACTCACAAA ACTTGAGAAC
GAATTGGTCA ATGGCCGAGG AGGAGACATG GGAGCACTGG TGGTGAGGCT GGAGGAGAGG ATGAGAAAGT CCATGGTGAA
GGAGAGGAGG AAGGCGTTCT TGCGCGCGTC GTTCTGGAGC GCGTACTCCG CGCTGTTCGA CTCCGACAAG CTGGTGAGGA
AGTGGGGGAG GCGCGTCCCC GGTGAGGCCG CCGTCGCAGA GAGCGTCGCC GGCGCAATCG GCGGGAACGA GAGCGTGCTG
AGGGCAATGC TGAGGGGTGC CGACAATGGC AACGGCTGCG GCAATCGGCT CGAGGTGGAA GACAAGGTGG TGAGGATTGG
GAGGGCTACC TATGGCAGGG TAGTGAAGAG GCAGGCAATG AGAGCTCTCT TCAGACTTAC ATTGGATGCT GACAGTAACA
AAAGCCTGTA G

Locus: Os03g0168700

Loading...

Locus: Os03g0168700

Loading...