Os03t0169100-01

Locus

Os03g0169100

Description

Ribulose-phosphate 3-epimerase, chloroplast precursor (EC 5.1.3.1) (Pentose-5-phosphate 3-epimerase) (PPE) (RPE) (R5P3E).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

RPE

Oryzabase Gene Name Synonym(s)

D-ribulose-5-phosphate 3-epimerase, chl-RPEase, chloroplast RPEase, chloroplast D-Ribulose-5-phosphate 3-Epimerase

Transcript Evidence

AK066306 (DDBJ, Best hit)

AK061772 (DDBJ, Best hit)

AK099215 (DDBJ, Best hit)

Protein Evidence

B8APA6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Biological Process: metabolic process (GO:0008152)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: ribulose-phosphate 3-epimerase activity (GO:0004750)

Functional domain (InterPro)

Ribulose-phosphate 3-epimerase (IPR000056)

Ribulose-phosphate binding barrel (IPR011060)

Aldolase-type TIM barrel (IPR013785)

Full-length cDNA

J013061C21 (Online Clone Ordering)

001-039-C12 (Online Clone Ordering)

J013084F18 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0169100-01)

Others

Oryzabase (13805)

Transcript

1274 bp

>Os03t0169100-01 Ribulose-phosphate 3-epimerase, chloroplast precursor (EC 5.1.3.1) (Pentose-5-phosphate 3-epimerase) (PPE) (RPE) (R5P3E).
GCCGCCACCGCTTCACCAAATCAAAAGCTCTCGCTGCTCCTCGAGAGGGAGTTGGTGGAG
AGAGAAAGAGAGAGAGAGAGATGGCGTCGCCGTCGTCGTCGTCGTCGCTGTGCTCGACCT
TCGCCTCGCCGCGCGCCGCCTCCCTCGGCCGCCGCCTCGCCTTCTCCTCGCCCAGGAAAG
CATTCCGAGTGAGGGCATCATCCAGGGTTGACAAGTTCTCGAAGAATGACATCATCGTGT
CCCCTTCCATTCTTTCTGCAAACTTTTCCAAGCTTGGCGAGCAGGTAAAAGCTGTGGAGG
TGGCAGGATGTGACTGGATTCATGTTGATGTCATGGATGGACGTTTTGTGCCAAATATCA
CAATCGGACCTTTGGTTGTTGATGCTCTGCGGCCAGTCACTGATCTTCCGTTGGATGTGC
ATCTGATGATTGTGGAACCTGAGCAACGAGTTCCAGATTTTATCAAGGCAGGTGCTGATA
TTGTTAGCGTTCACTGTGAGCAATCGTCAACCATCCATCTACACCGAACAGTCAATCAGA
TCAAAAGTCTTGGAGCAAAGGCTGGAGTTGTTTTGAATCCTGCAACCCCTCTCACTGCGA
TAGATTATGTACTTGATGTTGTTGATCTAGTATTGATTATGTCGGTGAATCCTGGGTTTG
GTGGGCAGAGCTTTATTGAAAGCCAAGTGAAGAAGATTGCAGAGTTGAGAAGATTATGTG
CAGAGAAGGGAGTAAACCCTTGGATTGAGGTTGATGGTGGAGTTGGTCCCAAAAACGCCT
ACAAGGTCATTGAAGCTGGGGCCAACGCCATTGTTGCTGGTTCAGCCGTTTTCGGGGCTC
CAGACTATGCAGAAGCTATCAAGGGAATCAAGACCAGCCAAAAACCTGTGGCTGTACCAG
CATGAGGATCCTAAAGTAGTATGCTGTGTACGTTGTTTTTGTTTACCAGTACCGCGGTTT
GTACAGATATGTGCCAAGCTGTACGTTATATTGGAGAAATTGAAGGAAGAAGAAAACGTG
GAGGGCGACCGTTTTTCTCACTGTCCGCGAAGATATACTACATATTCTCAGTGTCATGTG
ATACTACCGTGCTCACGAAATTGTTCATAATAAATATCGTTCTTTAGCAAAtcctataat
gatttacacttctagcatttgaaatttatccacaaatatatgcatttttagagtacTACT
TTTTGCCCCAGTAACAAACATATGCTCCGCACTGGAGTATTGGGTAATGTGACAGTTGAA
AATATAGTACTACC

CDS

825 bp

>Os03t0169100-01 Ribulose-phosphate 3-epimerase, chloroplast precursor (EC 5.1.3.1) (Pentose-5-phosphate 3-epimerase) (PPE) (RPE) (R5P3E).
ATGGCGTCGCCGTCGTCGTCGTCGTCGCTGTGCTCGACCTTCGCCTCGCCGCGCGCCGCC
TCCCTCGGCCGCCGCCTCGCCTTCTCCTCGCCCAGGAAAGCATTCCGAGTGAGGGCATCA
TCCAGGGTTGACAAGTTCTCGAAGAATGACATCATCGTGTCCCCTTCCATTCTTTCTGCA
AACTTTTCCAAGCTTGGCGAGCAGGTAAAAGCTGTGGAGGTGGCAGGATGTGACTGGATT
CATGTTGATGTCATGGATGGACGTTTTGTGCCAAATATCACAATCGGACCTTTGGTTGTT
GATGCTCTGCGGCCAGTCACTGATCTTCCGTTGGATGTGCATCTGATGATTGTGGAACCT
GAGCAACGAGTTCCAGATTTTATCAAGGCAGGTGCTGATATTGTTAGCGTTCACTGTGAG
CAATCGTCAACCATCCATCTACACCGAACAGTCAATCAGATCAAAAGTCTTGGAGCAAAG
GCTGGAGTTGTTTTGAATCCTGCAACCCCTCTCACTGCGATAGATTATGTACTTGATGTT
GTTGATCTAGTATTGATTATGTCGGTGAATCCTGGGTTTGGTGGGCAGAGCTTTATTGAA
AGCCAAGTGAAGAAGATTGCAGAGTTGAGAAGATTATGTGCAGAGAAGGGAGTAAACCCT
TGGATTGAGGTTGATGGTGGAGTTGGTCCCAAAAACGCCTACAAGGTCATTGAAGCTGGG
GCCAACGCCATTGTTGCTGGTTCAGCCGTTTTCGGGGCTCCAGACTATGCAGAAGCTATC
AAGGGAATCAAGACCAGCCAAAAACCTGTGGCTGTACCAGCATGA

Protein

275 aa

>Os03t0169100-01 Ribulose-phosphate 3-epimerase, chloroplast precursor (EC 5.1.3.1) (Pentose-5-phosphate 3-epimerase) (PPE) (RPE) (R5P3E).
MASPSSSSSLCSTFASPRAASLGRRLAFSSPRKAFRVRASSRVDKFSKNDIIVSPSILSA
NFSKLGEQVKAVEVAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEP
EQRVPDFIKAGADIVSVHCEQSSTIHLHRTVNQIKSLGAKAGVVLNPATPLTAIDYVLDV
VDLVLIMSVNPGFGGQSFIESQVKKIAELRRLCAEKGVNPWIEVDGGVGPKNAYKVIEAG
ANAIVAGSAVFGAPDYAEAIKGIKTSQKPVAVPA*

5'UTR

chr03:3713990..3714069 (+ strand) : 80 bp

CDS

chr03:3714070..3714164 (+ strand) : 95 bp

chr03:3714702..3714810 (+ strand) : 109 bp

chr03:3714959..3715099 (+ strand) : 141 bp

chr03:3715199..3715312 (+ strand) : 114 bp

chr03:3715771..3715849 (+ strand) : 79 bp

chr03:3716376..3716485 (+ strand) : 110 bp

chr03:3716557..3716613 (+ strand) : 57 bp

chr03:3716733..3716800 (+ strand) : 68 bp

chr03:3716926..3716977 (+ strand) : 52 bp

3'UTR

chr03:3716978..3717346 (+ strand) : 369 bp

FASTA

>Os03t0169100-01 class=Sequence position=chr03:3713990..3717346 (+ strand)
GCCGCCACCG CTTCACCAAA TCAAAAGCTC TCGCTGCTCC TCGAGAGGGA GTTGGTGGAG AGAGAAAGAG AGAGAGAGAG
ATGGCGTCGC CGTCGTCGTC GTCGTCGCTG TGCTCGACCT TCGCCTCGCC GCGCGCCGCC TCCCTCGGCC GCCGCCTCGC
CTTCTCCTCG CCCAGGTAGT TACCCCCACC GTTCGCTTCC GAGATTGCGC CCCCTTCTTC GCTGGTATGC GCCGCGGCCG
ACCCGATCTT TGCGAGCTCT CGCGCTGTGC GTATTACGTC CACATGGTTA GGGGTGGTTG GGCTTCGGGG TACCTCCCGG
ATTGGACAAA ACTCCATTCC TGAACGCCGG ATAGCATGTC AGAGTCAAAC CTTCTGGGAC TGGATGGGTT CATGAGCTTT
GAGCTGCCGG CGCAGGTTGA ACGAGCTAGT ATTGATGCTA TTTCTCCCAA CTGCTCTCAA GCTGCACCAG TTGACTTGAG
GAGTTCATCA GGACGGCATT TCTTAGAACC TTTACTGTTG CTATGATGCT ATCTGTTATT TGTGTTTTGT AAGTGATGTA
TGTATTGCCT AGTCATGATA AAACATGACA ACAAAAGGTA CAAATGCTGG TTAAACTTAA AATCACATGT TGAGGACTTC
ACTGCTTTCT TACCTTGGTT AAGTGCTGTG ATCTTAAGGT TCTCATTCTG TTTTTCCCTT GATGCTTTGC AGGAAAGCAT
TCCGAGTGAG GGCATCATCC AGGGTTGACA AGTTCTCGAA GAATGACATC ATCGTGTCCC CTTCCATTCT TTCTGCAAAC
TTTTCCAAGC TTGGCGAGCA GGTCTGTCAA GATTCTACCC TCCATCAAAC CACCATGACA TGGAAATATA TGTAGGAGGA
TCATTTAGGC TACTATATAT TGGAATAATA GATCGATATC ATGAGACAAA GAATAGGTTG ATAATATATT GTGTGAATAA
TATTACTAGG TAAAAGCTGT GGAGGTGGCA GGATGTGACT GGATTCATGT TGATGTCATG GATGGACGTT TTGTGCCAAA
TATCACAATC GGACCTTTGG TTGTTGATGC TCTGCGGCCA GTCACTGATC TTCCGTTGGA TGTGCATCTG GTACTTCTTG
AGAAGCCTTA CTGAAATTTT AGGTATTTAT GTGCTGTAAT TTTTCTTTCA CCCTTGCTAA TTTGGCGTTT GTTATCTTAT
TTATTGCAGA TGATTGTGGA ACCTGAGCAA CGAGTTCCAG ATTTTATCAA GGCAGGTGCT GATATTGTTA GCGTTCACTG
TGAGCAATCG TCAACCATCC ATCTACACCG AACAGTCAAT CAGGTAAAGA TTGGCATCTT TTACTAGTTA ATATTTGAGA
TAGCTCATCC TCGCTCTTTC AGTCATTCAT GAATTAGCAT ACCACTGTAG AAGTGTGGAT TCCTCTCCAA ATTGAATCAG
TATTTTGTTT TATGAGTTTT ACTGGTATGT GACCGGGAGG AAACTGGACT TTCACTAGTC TCCTGTCAAA GGATCATACT
GTAATATACT TGTATACTGT ACTTTAGGAC TACTTACCAA ATTGTTTCTT GGATCCTTTA TATACTAGAT AATGGTTATC
GTTTGCTCCT TGAGCTAACC ATTTCCTTGA CATGGTGATC GGGACTGCAA TAAGTTGATT TCTTACCTGT CTAATTCTAG
TTGAACTTGA GATATACTCC ATATTCATTT TTGGCAGTAA TTGCGTTTTT ATTCTAAGGA TAAAAATCTA AAAGTGACAT
AGTGGTCTCA CATTTTTTCA GATCAAAAGT CTTGGAGCAA AGGCTGGAGT TGTTTTGAAT CCTGCAACCC CTCTCACTGC
GATAGATTAT GTACTTGATG GTAAGACTAT TCTCACTCCA ATATTTATAG GGTGTTGACA CGTGTGTAAA TCTATTGATG
GATTGATGTC CAAATTCTAC TTGGTAGTCG TATGAATTTT GTTATTATTT TCAATGTATC AATCCTAATA TTAGTTGTTA
AGTGTGATGG GTTGATGTTG AAGGAGCACA CATGACATGT TTAGATTATG TTTGTAATTT TGTGAATTAG ACAAGTCACT
CCTGTTATTT AGTTACCTAT TGCAGTTTTT ATAAGCATAG CCATAATGCA ATTTTAGTTA AGAGTCAAAA CTGTGCTATT
TCTGGTGAAA ATTTGATGAG TATTGACTGC ATTCCAATCT TGACTTTCTT GACTATCCTG CCTGTAGTCA CTTCGTTTCC
TTGGATTAAG CATAATTATT AACAGCACTC ACAGTAGAAA TTTACATGTC TTTCTCATCG TACGACACTA TTATTTCTTT
AGTTCATCAA TAGCCCAACA GGCATATACT CCGACAACTG ACAAGCTACT ACATTTGTCT GCGCAGTTGT TGATCTAGTA
TTGATTATGT CGGTGAATCC TGGGTTTGGT GGGCAGAGCT TTATTGAAAG CCAAGTGAAG AAGATTGCAG AGTTGAGAAG
ATTATGTGCA GAGAAGGTAT ATCCTCATTT CCTGCATGTA TTCTCACTGA GCCAGTGCTC TAAGCGTGCA TTTCATTCTT
TTAATAGGGA GTAAACCCTT GGATTGAGGT TGATGGTGGA GTTGGTCCCA AAAACGCCTA CAAGGTCACC TGATTTCTAG
CTTTCTGTTA CTGTTATTTT TTTCACTACT GAATACCAAT AACAGTTTTG GACTAGAATT ATGGTTCAGT TGGGTGTTAA
TTTATTGTTT CTTTGAATAA CAGGTCATTG AAGCTGGGGC CAACGCCATT GTTGCTGGTT CAGCCGTTTT CGGGGCTCCA
GACTATGCAG AAGGCATGGC TTCTTTTCAG TGACATACAC ATTCAATCAT CAAACACTAA GTTCTTAAAC ATGAATTTCT
GACATAGTTT ACTAACAGAT AGTAATATGC TTATGTTTTT CCTCTTGCAA TTTTGCAGCT ATCAAGGGAA TCAAGACCAG
CCAAAAACCT GTGGCTGTAC CAGCATGAGG ATCCTAAAGT AGTATGCTGT GTACGTTGTT TTTGTTTACC AGTACCGCGG
TTTGTACAGA TATGTGCCAA GCTGTACGTT ATATTGGAGA AATTGAAGGA AGAAGAAAAC GTGGAGGGCG ACCGTTTTTC
TCACTGTCCG CGAAGATATA CTACATATTC TCAGTGTCAT GTGATACTAC CGTGCTCACG AAATTGTTCA TAATAAATAT
CGTTCTTTAG CAAAtcctat aatgatttac acttctagca tttgaaattt atccacaaat atatgcattt ttagagtacT
ACTTTTTGCC CCAGTAACAA ACATATGCTC CGCACTGGAG TATTGGGTAA TGTGACAGTT GAAAATATAG TACTACC

Locus: Os03g0169100

Loading...

Locus: Os03g0169100

Loading...