Os03t0170900-02

Locus

Os03g0170900

Description

Similar to Sucrose transporter.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SUT1

CGSNL Gene Name

SUCROSE TRANSPORTER 1

Oryzabase Gene Symbol Synonym(s)

OsSUT1, OsSUT2

Oryzabase Gene Name Synonym(s)

Sucrose transporter-1, Sucrose transporter 1

Transcript Evidence

AK109355 (DDBJ, Best hit)

Protein Evidence

Q10R54 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Major facilitator superfamily domain, general substrate transporter (IPR016196)

Full-length cDNA

006-205-F11 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0170900-02)

RiceXPro (AK109355)

Others

Oryzabase (6297)

KEGG (Os03t0170900-02)

Transcript

1210 bp

>Os03t0170900-02 Similar to Sucrose transporter.
GATTTTCCTGTCCCTGTGCTTGGTTATAACTCTGATATTTGCCAAGGAAGTTCCATTCAA
AGGAAATGCAGCCCTCCCAACAAAATCAAACGAGCCAGCTGAGCCTGAAGGCACTGGTCC
ACTAGCAGTGTTGAAAGGCTTCAGGAACTTACCTACTGGGATGCCTTCTGTGCTTATTGT
GACTGGCCTTACCTGGTTGTCTTGGTTCCCATTCATCCTCTACGACACTGACTGGATGGG
CCGTGAGATCTACCACGGTGACCCAAAGGGAACTGATCCTCAGATCGAGGCTTTCAACCA
GGGTGTCAGGGCAGGTGCATTTGGCCTGCTACTGAATTCGATTGTGCTAGGATTCAGCTC
ATTCTTGATTGAACCAATGTGCCGGAAAGTCGGGCCAAGGGTGGTGTGGGTGACGAGCAA
TTTCCTCGTCTGCATCGCCATGGCTGCAACTGCACTGATCAGCTTCTGGTCACTCAAGGA
CTTCCATGGAACTGTTCAGAAAGCCATCACTGCAGACAAGAGCATCAAGGCTGTCTGCCT
CGTCCTCTTTGCGTTTCTTGGAGTCCCTCTCGCCGTTCTGTACAGTGTTCCCTTCGCAGT
GACGGCGCAATTAGCGGCCACTAGAGGGGGTGGCCAAGGGCTCTGCACCGGCGTCCTCAA
CATCTCCATCGTCATCCCTCAGGTGGTCATCGCGCTGGGAGCCGGGCCGTGGGACGAGCT
GTTCGGGAAGGGGAACATCCCGGCGTTCGGCCTCGCCTCGGGATTCGCGCTCATCGGCGG
CGTCGCCGGAATATTCCTGCTGCCCAAGATCTCCAAGCGCCAGTTCCGGTCGGTCAGCAT
GGGCGGCGGTCACTGACCGCCCCGCTCTCGCCGCCGGCTGCGGCGGCGGCGGCGGCCGGA
GCAGCGCCGCCGGAAGTGGTGAGCTTTGTAGTTCTCGTTTGCAATGGATCAAAGGAGCCC
CCTCTTTTTTTTTACATAGGGTAATTAATTAATTAAGGCTGTTAATTAGGAAGGGGTGAG
GTGGCCCTGCAGCTGGGGCCCACGCTTTGTTGCCACCTCGGTAGAAGAGAATAAGCAGAT
CATGCAGATAATATGGAACTGTAAAACTGTTTTGTGTTGTGTGTGTGTGCAGTGTGCTTG
GTAATTAGTGTGTAATGAATGGTCAGGAGAAGTGCAGTGAACTAAGTGAAAGTGAGCTTC
CATCATCATC

CDS

855 bp

>Os03t0170900-02 Similar to Sucrose transporter.
ATTTTCCTGTCCCTGTGCTTGGTTATAACTCTGATATTTGCCAAGGAAGTTCCATTCAAA
GGAAATGCAGCCCTCCCAACAAAATCAAACGAGCCAGCTGAGCCTGAAGGCACTGGTCCA
CTAGCAGTGTTGAAAGGCTTCAGGAACTTACCTACTGGGATGCCTTCTGTGCTTATTGTG
ACTGGCCTTACCTGGTTGTCTTGGTTCCCATTCATCCTCTACGACACTGACTGGATGGGC
CGTGAGATCTACCACGGTGACCCAAAGGGAACTGATCCTCAGATCGAGGCTTTCAACCAG
GGTGTCAGGGCAGGTGCATTTGGCCTGCTACTGAATTCGATTGTGCTAGGATTCAGCTCA
TTCTTGATTGAACCAATGTGCCGGAAAGTCGGGCCAAGGGTGGTGTGGGTGACGAGCAAT
TTCCTCGTCTGCATCGCCATGGCTGCAACTGCACTGATCAGCTTCTGGTCACTCAAGGAC
TTCCATGGAACTGTTCAGAAAGCCATCACTGCAGACAAGAGCATCAAGGCTGTCTGCCTC
GTCCTCTTTGCGTTTCTTGGAGTCCCTCTCGCCGTTCTGTACAGTGTTCCCTTCGCAGTG
ACGGCGCAATTAGCGGCCACTAGAGGGGGTGGCCAAGGGCTCTGCACCGGCGTCCTCAAC
ATCTCCATCGTCATCCCTCAGGTGGTCATCGCGCTGGGAGCCGGGCCGTGGGACGAGCTG
TTCGGGAAGGGGAACATCCCGGCGTTCGGCCTCGCCTCGGGATTCGCGCTCATCGGCGGC
GTCGCCGGAATATTCCTGCTGCCCAAGATCTCCAAGCGCCAGTTCCGGTCGGTCAGCATG
GGCGGCGGTCACTGA

Protein

285 aa

>Os03t0170900-02 Similar to Sucrose transporter.
IFLSLCLVITLIFAKEVPFKGNAALPTKSNEPAEPEGTGPLAVLKGFRNLPTGMPSVLIV
TGLTWLSWFPFILYDTDWMGREIYHGDPKGTDPQIEAFNQGVRAGAFGLLLNSIVLGFSS
FLIEPMCRKVGPRVVWVTSNFLVCIAMAATALISFWSLKDFHGTVQKAITADKSIKAVCL
VLFAFLGVPLAVLYSVPFAVTAQLAATRGGGQGLCTGVLNISIVIPQVVIALGAGPWDEL
FGKGNIPAFGLASGFALIGGVAGIFLLPKISKRQFRSVSMGGGH*

5'UTR

chr03:3799435..3799435 (- strand) : 1 bp

CDS

chr03:3799240..3799434 (- strand) : 195 bp

chr03:3798978..3799121 (- strand) : 144 bp

chr03:3798635..3798868 (- strand) : 234 bp

chr03:3798469..3798532 (- strand) : 64 bp

chr03:3798342..3798385 (- strand) : 44 bp

chr03:3798052..3798225 (- strand) : 174 bp

3'UTR

chr03:3797698..3798051 (- strand) : 354 bp

FASTA

>Os03t0170900-02 class=Sequence position=chr03:3797698..3799435 (- strand)
GATTTTCCTG TCCCTGTGCT TGGTTATAAC TCTGATATTT GCCAAGGAAG TTCCATTCAA AGGAAATGCA GCCCTCCCAA
CAAAATCAAA CGAGCCAGCT GAGCCTGAAG GCACTGGTCC ACTAGCAGTG TTGAAAGGCT TCAGGAACTT ACCTACTGGG
ATGCCTTCTG TGCTTATTGT GACTGGCCTT ACCTGGGTAT GCAATATACA TCAGAAAAAG AACTTTTCAG ATTATTGAAA
AAATTGCTAC TAGATCATAT CTTAGTTATA TCTTATAGTA CCTTACCTTT TCTATGATAT GATTGTCCTT GTAGTTGTCT
TGGTTCCCAT TCATCCTCTA CGACACTGAC TGGATGGGCC GTGAGATCTA CCACGGTGAC CCAAAGGGAA CTGATCCTCA
GATCGAGGCT TTCAACCAGG GTGTCAGGGC AGGTGCATTT GGCCTGCTAC TGAATTCGGT AAGATCTGAT TGGTTTCTGA
ATTCTGATTG CCACAACTAC TGTCAAATCT TTAACACTCA AGCCATGTTC TTTGGCAGCA ACTAACCATG GGCTTCTGAT
CGTGCAGATT GTGCTAGGAT TCAGCTCATT CTTGATTGAA CCAATGTGCC GGAAAGTCGG GCCAAGGGTG GTGTGGGTGA
CGAGCAATTT CCTCGTCTGC ATCGCCATGG CTGCAACTGC ACTGATCAGC TTCTGGTCAC TCAAGGACTT CCATGGAACT
GTTCAGAAAG CCATCACTGC AGACAAGAGC ATCAAGGCTG TCTGCCTCGT CCTCTTTGCG TTTCTTGGAG TCCCTCTCGC
CGTAAGAATC ACTGACACTT CAACTTAAAC ACATTGCTAA AAAAAATTAT TTCCTCAAGA ATGCCTTATC CTGATGAACT
GTCTGAAAAT TTGCGCGATG CAGGTTCTGT ACAGTGTTCC CTTCGCAGTG ACGGCGCAAT TAGCGGCCAC TAGAGGGGGT
GGCCAAGGTA TGAATCCCAA CATTCTTGCA GCTTTTCTTG ACATAATTCG GTGTTGTTTG GATGCTGGTC TAATCCATGG
CGATCTGCAG GGCTCTGCAC CGGCGTCCTC AACATCTCCA TCGTCATCCC TCAGGTTAAT TAGCTGCCAA ATTCTAATCC
GTTTCCCTTG AAACCGAATC AGATATACTT CATGGATTAT TAGAATTTGA ATGCTCATGG ATTCATGGTT GCGTGGTGTT
CTTCCCTCAG GTGGTCATCG CGCTGGGAGC CGGGCCGTGG GACGAGCTGT TCGGGAAGGG GAACATCCCG GCGTTCGGCC
TCGCCTCGGG ATTCGCGCTC ATCGGCGGCG TCGCCGGAAT ATTCCTGCTG CCCAAGATCT CCAAGCGCCA GTTCCGGTCG
GTCAGCATGG GCGGCGGTCA CTGACCGCCC CGCTCTCGCC GCCGGCTGCG GCGGCGGCGG CGGCCGGAGC AGCGCCGCCG
GAAGTGGTGA GCTTTGTAGT TCTCGTTTGC AATGGATCAA AGGAGCCCCC TCTTTTTTTT TACATAGGGT AATTAATTAA
TTAAGGCTGT TAATTAGGAA GGGGTGAGGT GGCCCTGCAG CTGGGGCCCA CGCTTTGTTG CCACCTCGGT AGAAGAGAAT
AAGCAGATCA TGCAGATAAT ATGGAACTGT AAAACTGTTT TGTGTTGTGT GTGTGTGCAG TGTGCTTGGT AATTAGTGTG
TAATGAATGG TCAGGAGAAG TGCAGTGAAC TAAGTGAAAG TGAGCTTCCA TCATCATC

Locus: Os03g0170900

Loading...

Locus: Os03g0170900

Loading...