Os03t0174900-01

Locus

Os03g0174900

Description

Similar to RAPB protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP2C

CGSNL Gene Name

HAP2 SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP2C, NF-YA, CBF-B, NF-YA1, OsNF-YA1, NFYA1

Oryzabase Gene Name Synonym(s)

NUCLEAR FACTOR-Y subunit A1, NUCLEAR FACTOR-Y subunit NF-YA1, NF-YA transcription factor 1, NF-YA subunit 1, NF-YA family 1

Transcript Evidence

AK069348 (DDBJ, Best hit)

Protein Evidence

O49915 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Cellular Component: CCAAT-binding factor complex (GO:0016602)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Functional domain (InterPro)

CCAAT-binding transcription factor, subunit B (IPR001289)

CCAAT-binding factor, conserved site (IPR018362)

Full-length cDNA

J023014B08 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0174900-01)

Others

Oryzabase (8475)

Transcript

1255 bp

>Os03t0174900-01 Similar to RAPB protein.
GAGAGAGAGAAGGAGAGGGGCTTTGCACTTGCAGAGGAGAGAAGCAAGGTGAGAAGTGAG
GAGGCAGCAAGGGAGGAGGTTTGCCGGAGAGGGGACATGCTCCCTCCTCATCTCACAGAA
AATGGCACAGTAATGATTCAGTTTGGTCATAAAATGCCTGACTACGAGTCATCAGCTACC
CAATCAACTAGTGGATCTCCTCGTGAAGTGTCTGGAATGAGCGAAGGAAGCCTCAATGAG
CAGAATGATCAATCTGGTTTGGACTAGACACACCATATGCATTTTTTGTATCAGTAAATA
ATATTGCAATACAGCACCTCCAGGGTAAAAGGAATATTGATGGATGCAAAGTTTGTTTGC
ATCTACACTACTGAAGTTATGTGACATTTCTTTTCTTCTTGTACTAATGCTAGGTAATCT
TGATGGTTACACGAAGAGTGATGAAGGTAAGATGATGTCAGCTTTATCTCTGGGCAAATC
AGAAACTGTGTATGCACATTCGGAACCTGACCGTAGCCAACCCTTTGGCATATCATATCC
ATATGCTGATTCGTTCTATGGTGGTGCTGTAGCGACTTATGGCACACATGCTATTATGCA
TCCCCAGATTGTGGGCGTGATGTCATCCTCCCGAGTCCCGCTACCAATAGAACCAGCCAC
CGAAGAGCCTATTTATGTAAATGCAAAGCAATACCATGCGATTCTCCGAAGGAGACAGCT
CCGTGCAAAGTTAGAGGCTGAAAACAAGCTGGTGAAAAACCGCAAGCCGTACCTCCATGA
ATCCCGGCATCAACACGCGATGAAGAGAGCTCGGGGAACAGGGGGGAGATTCCTCAACAC
AAAGCAGCAGCCTGAAGCTTCAGATGGTGGCACCCCAAGGCTCGTCTCTGCAAACGGCGT
TGTGTTCTCAAAGCACGAGCACAGCTTGTCGTCCAGTGATCTCCATCATCGTCGTGCGAA
AGAGGGCGCTTGAGATCCTCGCCGTTTCTGTCATGGCAAATCATCCTTGGCTTATGTGTG
GTGCCCAGCAAAAAAAAATCTGACTGAACCTGTGTGTAAACTGATGGGTATGGGTGGGTT
TTGTGCAACTGTAACTAGGGTGCTTGACATCTGTGTCTGTTGTTCCTCTGCCTCCTTAGT
TTGGAGACGGTGCAGCTGCAGCTGGTACCAGTAATCTGATCATGCTAGACTTGTGACAAG
GACAAAACTAGCACCCCGTTATGTTTCCTGGCTTCTGAATTTGGTGGTCATTCAG

CDS

630 bp

>Os03t0174900-01 Similar to RAPB protein.
ATGCAAAGTTTGTTTGCATCTACACTACTGAAGTTATGTGACATTTCTTTTCTTCTTGTA
CTAATGCTAGGTAATCTTGATGGTTACACGAAGAGTGATGAAGGTAAGATGATGTCAGCT
TTATCTCTGGGCAAATCAGAAACTGTGTATGCACATTCGGAACCTGACCGTAGCCAACCC
TTTGGCATATCATATCCATATGCTGATTCGTTCTATGGTGGTGCTGTAGCGACTTATGGC
ACACATGCTATTATGCATCCCCAGATTGTGGGCGTGATGTCATCCTCCCGAGTCCCGCTA
CCAATAGAACCAGCCACCGAAGAGCCTATTTATGTAAATGCAAAGCAATACCATGCGATT
CTCCGAAGGAGACAGCTCCGTGCAAAGTTAGAGGCTGAAAACAAGCTGGTGAAAAACCGC
AAGCCGTACCTCCATGAATCCCGGCATCAACACGCGATGAAGAGAGCTCGGGGAACAGGG
GGGAGATTCCTCAACACAAAGCAGCAGCCTGAAGCTTCAGATGGTGGCACCCCAAGGCTC
GTCTCTGCAAACGGCGTTGTGTTCTCAAAGCACGAGCACAGCTTGTCGTCCAGTGATCTC
CATCATCGTCGTGCGAAAGAGGGCGCTTGA

Protein

210 aa

>Os03t0174900-01 Similar to RAPB protein.
MQSLFASTLLKLCDISFLLVLMLGNLDGYTKSDEGKMMSALSLGKSETVYAHSEPDRSQP
FGISYPYADSFYGGAVATYGTHAIMHPQIVGVMSSSRVPLPIEPATEEPIYVNAKQYHAI
LRRRQLRAKLEAENKLVKNRKPYLHESRHQHAMKRARGTGGRFLNTKQQPEASDGGTPRL
VSANGVVFSKHEHSLSSSDLHHRRAKEGA*

5'UTR

chr03:4005303..4005420 (- strand) : 118 bp

chr03:4003712..4003936 (- strand) : 225 bp

CDS

chr03:4003529..4003711 (- strand) : 183 bp

chr03:4003371..4003439 (- strand) : 69 bp

chr03:4002754..4002924 (- strand) : 171 bp

chr03:4002371..4002577 (- strand) : 207 bp

3'UTR

chr03:4002089..4002370 (- strand) : 282 bp

FASTA

>Os03t0174900-01 class=Sequence position=chr03:4002089..4005420 (- strand)
GAGAGAGAGA AGGAGAGGGG CTTTGCACTT GCAGAGGAGA GAAGCAAGGT GAGAAGTGAG GAGGCAGCAA GGGAGGAGGT
TTGCCGGAGA GGGGACATGC TCCCTCCTCA TCTCACAGGT ATCCCCTCTC TCCTCCTCCT CATCCGCTTC TCTGACTCGC
TTCTCCGTAG ACTTGTAATC CGTGGCTTGT TTCTTTCTCC TCCACTTTGT GGACTCTGTT CCAACGCAAG CCGATTCTTG
CCATTGCTGA CCGTATCTTG GACCCGGCTG GGTTTGTGGT GGTTTTGATT TCTTGGTGGA TCTGGCCGGT TTCTTCGTTG
TTGGCTTGGT TTTTAGTTGA TGAGGCGCCG TGATTTGTAG ATGCATTCTT GGGTGGAGGT GAGGGTGGTT GCAACTGCGT
TGTCTCTGAC TCTCCGTGGT AGCAACCTAA GACCATAAGA CGATGCTTGT AACTTGTTCT GTTGTTCAGT TTGATAGTTC
AACTATCTGT TTCTAATTGA CCATGGTTGG GTGGGCTGCT TAGTTCCTAT GAATTCATCA CTTTTGTTAG TTCGGTTTGT
TTAGGTCCGT GACAAGGGGG CAAGTGAGGG GAATTGGATG ATTGGAACGG TATTGGATGA TTGGAATATT GGATCCGAGT
AGAACTTAAT TAGTTTAAAC CTTTTCTGTA TTAATTACTT GTTTGCACAC AAATTCGCTT GGTGGAGAGG TAGTAGGATC
CAGATGGCAT GTCAGCTGTG AATTTATTTT AGGGGTTAGT TGTGAGCTTC TGAATTAATA TTGCTTTCTT TACAAATAAA
TTTACTTTTC CACATGAGTA TTGAGTAATA TGATTATTGG GAGTGGGGAG AACCGCTGGC TTTGTGTCAC AGCGATTTGG
AACTGGCTAG TGCTGAAGTG AGTTATTGAA GGGATTTGTC TCATCACATA GTTTGATAGT AGTAGGCTAG TAGCTTTTAC
ATCTGACATG AACGATCGAA TTTTTGAAAG GAGTTAACAA GTTTATTTAT AACAGCTCTG TGAACATTTT TAGTCATGTT
CTGGCAAATA CATGGATCAG GGCAACATTC AACATGTCTA GATTGATCAG TTTTAAGTGA ATCTGTCTAC ACAATTGATA
GATATACAAG TTATTTTCAG TAACAGAATA TGGAAAATAA TATTATTCAT TAATATTTCA TTTGTCCTTG CGATTGACTG
ATCTTCTCCT TAAAAAACTC AGACAGTAGA ACTGAAAAGC AAGAGATGAG AAAGCCCATG AGAAGAGGCA TTAGGAAAAG
AGAAAACATA TTGTTCAATT CTAAGGCACC ATTTGGAACA CGAGAATTTC CAATTTTTGT ATGATCTGAA CTGCTTGTAA
AATTCTTGCA TTCTAAATAG GGCCTAATAT TGCAAATACC GCTCTCCTAA CTAGATGTCT ATTTTCTTGC ATCTCTAGCT
TTCATGCAAC TAAATTTAAA ACATCTACTT CATTATTCTT GCAGAAAATG GCACAGTAAT GATTCAGTTT GGTCATAAAA
TGCCTGACTA CGAGTCATCA GCTACCCAAT CAACTAGTGG ATCTCCTCGT GAAGTGTCTG GAATGAGCGA AGGAAGCCTC
AATGAGCAGA ATGATCAATC TGGTTTGGAC TAGACACACC ATATGCATTT TTTGTATCAG TAAATAATAT TGCAATACAG
CACCTCCAGG GTAAAAGGAA TATTGATGGA TGCAAAGTTT GTTTGCATCT ACACTACTGA AGTTATGTGA CATTTCTTTT
CTTCTTGTAC TAATGCTAGG TAATCTTGAT GGTTACACGA AGAGTGATGA AGGTAAGATG ATGTCAGCTT TATCTCTGGG
CAAATCAGAA ACTGTGTATG CACATTCGGA ACCTGACCGT AGCCAACCCT TTGTAAGTGT CTTTACGTGG CATAAATCTT
GGTAACTTGA ATTTCTTCAT TGGCAAGTCT GTGAGTCAAG AAAGATGCTT TACCTTTTCA GGGCATATCA TATCCATATG
CTGATTCGTT CTATGGTGGT GCTGTAGCGA CTTATGGCAC ACATGCTATT GTAAGTGACC TTTGTGCTAT CCAAGGTTTC
CTTTATTAAT TCCATTTACT TTCTTGATCT GGCAGTTATA AATGGAATTC ATCCAAACTC GGCGAAATTC CAATCAAATT
AAGAATGGGA TTTCGTTTTA TCTCATTCTC ATTTACCTTT TTGGTTCCAA ACTTCCAGCC TAATGTTCTT GTGTGCGCGC
TTATGTGCTT TAGGTATATT CATGGGTTGT TAAGAATGGG ATTTCGTTTT TGTGGGATAA TCTCTGACTG TTTTGACTAA
ACTAAGCAAA ATTCCAATCA TTTTTTTACT GTACAAAGGC AGTGTGTTAT TCTTTATCTT TTCTCATTAT CATCCTCCTG
ATGAGAATAG TTTAATTTTC TTGCATATGC TCGGCCCAAT ATGTTTCTAT TCAATATCAC AAAGTCATCC TCATCTAATA
TCAATAATTC AAACAGATGC ATCCCCAGAT TGTGGGCGTG ATGTCATCCT CCCGAGTCCC GCTACCAATA GAACCAGCCA
CCGAAGAGCC TATTTATGTA AATGCAAAGC AATACCATGC GATTCTCCGA AGGAGACAGC TCCGTGCAAA GTTAGAGGCT
GAAAACAAGC TGGTGAAAAA CCGCAAGGTA TTTCGTCGCT CTTTCTGACT GAAGTTTTAT TAGGAGAAAT TCTTGAGAGA
CTAGCCATTG GCCCTTTTTG CTCAGAATGT GCGGAAAATT TCCTCTCTTC CTTTCACTTT CCCTTCATGA ATTCTAGCTC
ACGGTTTCAC TAAAAGCGGC ATAACGTTTA TATTTGTGTT CAGCCGTACC TCCATGAATC CCGGCATCAA CACGCGATGA
AGAGAGCTCG GGGAACAGGG GGGAGATTCC TCAACACAAA GCAGCAGCCT GAAGCTTCAG ATGGTGGCAC CCCAAGGCTC
GTCTCTGCAA ACGGCGTTGT GTTCTCAAAG CACGAGCACA GCTTGTCGTC CAGTGATCTC CATCATCGTC GTGCGAAAGA
GGGCGCTTGA GATCCTCGCC GTTTCTGTCA TGGCAAATCA TCCTTGGCTT ATGTGTGGTG CCCAGCAAAA AAAAATCTGA
CTGAACCTGT GTGTAAACTG ATGGGTATGG GTGGGTTTTG TGCAACTGTA ACTAGGGTGC TTGACATCTG TGTCTGTTGT
TCCTCTGCCT CCTTAGTTTG GAGACGGTGC AGCTGCAGCT GGTACCAGTA ATCTGATCAT GCTAGACTTG TGACAAGGAC
AAAACTAGCA CCCCGTTATG TTTCCTGGCT TCTGAATTTG GTGGTCATTC AG

Locus: Os03g0174900

Loading...

Locus: Os03g0174900

Loading...