Os03t0177400-01

Locus

Os03g0177400

Description

EF-1 alpha.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RFA1

CGSNL Gene Name

ELONGATION FACTOR 1A1

Oryzabase Gene Symbol Synonym(s)

rfa1*, REFA1, refa1, OseEF-1A, eEF-1A, Osef1a1

Oryzabase Gene Name Synonym(s)

rice elongation factor 1A (eEFIA)-1, rice elongation factor 1A-1, ELONGATION FACTOR 1A, Elongation factor 1-alpha, EF-1-alpha, eukaryotic translation elongation factor 1A

Transcript Evidence

AK105030 (DDBJ, Best hit)

AK072648 (DDBJ, Best hit)

AK119172 (DDBJ, Best hit)

Protein Evidence

B8APM5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: translational elongation (GO:0006414)

Cellular Component: cytoplasm (GO:0005737)

Molecular Function: translation elongation factor activity (GO:0003746)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Protein synthesis factor, GTP-binding (IPR000795)

Translation elongation factor EFTu/EF1A, C-terminal (IPR004160)

Translation elongation factor EFTu/EF1A, domain 2 (IPR004161)

Translation elongation factor EF1A, eukaryotic/archaeal (IPR004539)

Translation elongation/initiation factor/Ribosomal, beta-barrel (IPR009000)

Translation elongation factor EF1A/initiation factor IF2gamma, C-terminal (IPR009001)

Full-length cDNA

001-012-F06 (Online Clone Ordering)

J023126K23 (Online Clone Ordering)

001-037-A11 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0177400-01)

RiceXPro (AK105030)

Others

Oryzabase (2069)

KEGG (Os03t0177400-01 (EC:3.6.5.3))

Transcript

1632 bp

>Os03t0177400-01 EF-1 alpha.
CCCCTCTCCCATCTCACCCCGCCGCCGCCGCCGCCGCAGCCTCCTCAAGGCTGCTCCCAT
CCTCTCCTTCGAGTTAGCTTCCTCCTTATTCAACCATGGGTAAGGAGAAGACGCACATCA
ACATTGTGGTCATTGGCCACGTCGACTCCGGCAAGTCGACCACCACGGGCCATCTGATCT
ACAAGCTTGGAGGTATCGACAAGCGTGTGATTGAGAGGTTCGAGAAGGAAGCCGCTGAGA
TGAACAAGAGGTCCTTCAAGTACGCGTGGGTGCTTGACAAGCTCAAGGCCGAGCGTGAGA
GAGGTATCACCATCGATATCGCCCTGTGGAAGTTCGAGACCACCAAGTACTACTGCACGG
TCATCGATGCCCCTGGTCACCGTGACTTCATCAAGAACATGATCACGGGTACCTCCCAGG
CTGACTGTGCCGTGCTCATCATTGACTCCACCACTGGTGGTTTTGAGGCTGGTATCTCCA
AGGATGGCCAGACCCGTGAGCACGCTCTTCTTGCTTTCACTCTTGGAGTGAAGCAGATGA
TCTGCTGCTGCAACAAGATGGATGCCACCACTCCCAAGTACTCCAAGGCCCGTTACGATG
AAATCGTGAAGGAAGTCTCATCCTACCTGAAGAAGGTCGGCTACAACCCTGACAAGATTC
CCTTCGTTCCCATCTCTGGGTTTGAGGGTGACAACATGATTGAGAGGTCCACCAACCTTG
ACTGGTACAAGGGCCCCACCTTGCTTGAGGCTCTTGACCAGATCAACGAGCCCAAGAGGC
CATCAGACAAGCCCCTGCGTCTTCCCCTTCAGGACGTGTACAAGATCGGTGGTATTGGCA
CCGTGCCTGTGGGTCGTGTTGAGACTGGAGTCCTCAAGCCTGGTATGGTGGTGACCTTTG
GTCCCAGCGGCCTGACCACTGAGGTCAAGTCGGTTGAGATGCACCACGAGGCTCTCCAGG
AGGCTCTTCCTGGTGACAACGTCGGGTTCAACGTGAAGAACGTTGCGGTGAAGGATCTGA
AGCGTGGGTACGTGGCCTCCAACTCCAAGGATGACCCTGCCAAGGAGGCTGCCAGCTTCA
CCTCCCAGGTGATCATCATGAACCACCCTGGCCAGATCGGCAACGGCTACGCCCCAGTGC
TGGACTGCCACACCTCCCACATTGCCGTCAAGTTTGCTGAGCTGGTGACCAAGATCGACA
GACGATCTGGTAAGGAGCTGGAGAAGGAGCCCAAGTTCCTCAAGAACGGTGATGCTGGTA
TGGTTAAGATGATTCCCACCAAGCCCATGGTTGTGGAGACCTTCTCTGAGTACCCTCCTC
TTGGTCGTTTTGCCGTGCGGGACATGAGGCAAACGGTGGCTGTTGGCGTCATCAAGAACG
TGGAGAAGAAGGACCCAACCGGTGCCAAGGTGACCAAGGCTGCCGCCAAGAAGAAATGAG
CCTCGTTCAAGTGGTGCTTTCCATATCTGCATTTGAGATATCTAGCTCTTTTAGTACTCG
TTAAGTTTTGTCGACGGTCATTTCAGTTGTTGCATTGACCGTTAATATCTGCTCGCTTTG
TGCACTATGTCAGTCATTTAAAACTCTATTTTCTGTTCGGTTTAAACTTGGATGTTAAGA
CTTATTATTGCC

CDS

1344 bp

>Os03t0177400-01 EF-1 alpha.
ATGGGTAAGGAGAAGACGCACATCAACATTGTGGTCATTGGCCACGTCGACTCCGGCAAG
TCGACCACCACGGGCCATCTGATCTACAAGCTTGGAGGTATCGACAAGCGTGTGATTGAG
AGGTTCGAGAAGGAAGCCGCTGAGATGAACAAGAGGTCCTTCAAGTACGCGTGGGTGCTT
GACAAGCTCAAGGCCGAGCGTGAGAGAGGTATCACCATCGATATCGCCCTGTGGAAGTTC
GAGACCACCAAGTACTACTGCACGGTCATCGATGCCCCTGGTCACCGTGACTTCATCAAG
AACATGATCACGGGTACCTCCCAGGCTGACTGTGCCGTGCTCATCATTGACTCCACCACT
GGTGGTTTTGAGGCTGGTATCTCCAAGGATGGCCAGACCCGTGAGCACGCTCTTCTTGCT
TTCACTCTTGGAGTGAAGCAGATGATCTGCTGCTGCAACAAGATGGATGCCACCACTCCC
AAGTACTCCAAGGCCCGTTACGATGAAATCGTGAAGGAAGTCTCATCCTACCTGAAGAAG
GTCGGCTACAACCCTGACAAGATTCCCTTCGTTCCCATCTCTGGGTTTGAGGGTGACAAC
ATGATTGAGAGGTCCACCAACCTTGACTGGTACAAGGGCCCCACCTTGCTTGAGGCTCTT
GACCAGATCAACGAGCCCAAGAGGCCATCAGACAAGCCCCTGCGTCTTCCCCTTCAGGAC
GTGTACAAGATCGGTGGTATTGGCACCGTGCCTGTGGGTCGTGTTGAGACTGGAGTCCTC
AAGCCTGGTATGGTGGTGACCTTTGGTCCCAGCGGCCTGACCACTGAGGTCAAGTCGGTT
GAGATGCACCACGAGGCTCTCCAGGAGGCTCTTCCTGGTGACAACGTCGGGTTCAACGTG
AAGAACGTTGCGGTGAAGGATCTGAAGCGTGGGTACGTGGCCTCCAACTCCAAGGATGAC
CCTGCCAAGGAGGCTGCCAGCTTCACCTCCCAGGTGATCATCATGAACCACCCTGGCCAG
ATCGGCAACGGCTACGCCCCAGTGCTGGACTGCCACACCTCCCACATTGCCGTCAAGTTT
GCTGAGCTGGTGACCAAGATCGACAGACGATCTGGTAAGGAGCTGGAGAAGGAGCCCAAG
TTCCTCAAGAACGGTGATGCTGGTATGGTTAAGATGATTCCCACCAAGCCCATGGTTGTG
GAGACCTTCTCTGAGTACCCTCCTCTTGGTCGTTTTGCCGTGCGGGACATGAGGCAAACG
GTGGCTGTTGGCGTCATCAAGAACGTGGAGAAGAAGGACCCAACCGGTGCCAAGGTGACC
AAGGCTGCCGCCAAGAAGAAATGA

Protein

448 aa

>Os03t0177400-01 EF-1 alpha.
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK
VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD
VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
AELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT
VAVGVIKNVEKKDPTGAKVTKAAAKKK*

5'UTR

chr03:4094567..4094639 (+ strand) : 73 bp

chr03:4095172..4095193 (+ strand) : 22 bp

CDS

chr03:4095194..4095655 (+ strand) : 462 bp

chr03:4096358..4097239 (+ strand) : 882 bp

3'UTR

chr03:4097240..4097432 (+ strand) : 193 bp

FASTA

>Os03t0177400-01 class=Sequence position=chr03:4094567..4097432 (+ strand)
CCCCTCTCCC ATCTCACCCC GCCGCCGCCG CCGCCGCAGC CTCCTCAAGG CTGCTCCCAT CCTCTCCTTC GAGGTCAGCT
GCAGATCTTC TCTCTTCTCC TTGTTTGCGC CGGTTCATGG TAGTTCGTAG CCGTAGATCT GATTCGATGG AGCGAGGTTT
GGGTGATTTG ATGCCTGGGC ATGTTGTTTT TGTCCATTAT TAGTAACTTT TTCTGTGTAT TCGTCTCACT GCTATGATCT
TAGTTTGCTG TTCGTTGACG CGATGATTTA TTGACTTGTC GGTGAATCAT TTATGTACGT TGAAAATTAT CGGTAGAATC
GGACTATTAA CTTGATGTGC TGCAGAATCA TGTACATAAG TTGAAAATCA TCGGTAGAAT CAGTAGAAGT ATTTCTATCT
AGAATCCGTT CGAATATCTC TGTTTTTATG TTCGAATAGA TGGTGTTATC GTCTATGCCT GGTTCGGTTT GGTCGATTAC
TGCGCGTTAG CACTTATAAT TGATGTCGAA GTTCATCTGA TCTGTGAGCT TGCCTGTAAT ATTATTTGGA GTTAGAAATT
ATGCACGCCT GTTGTTTCTA ATCTTTGTTT CGTTCTGTTT TGCAGTTAGC TTCCTCCTTA TTCAACCATG GGTAAGGAGA
AGACGCACAT CAACATTGTG GTCATTGGCC ACGTCGACTC CGGCAAGTCG ACCACCACGG GCCATCTGAT CTACAAGCTT
GGAGGTATCG ACAAGCGTGT GATTGAGAGG TTCGAGAAGG AAGCCGCTGA GATGAACAAG AGGTCCTTCA AGTACGCGTG
GGTGCTTGAC AAGCTCAAGG CCGAGCGTGA GAGAGGTATC ACCATCGATA TCGCCCTGTG GAAGTTCGAG ACCACCAAGT
ACTACTGCAC GGTCATCGAT GCCCCTGGTC ACCGTGACTT CATCAAGAAC ATGATCACGG GTACCTCCCA GGCTGACTGT
GCCGTGCTCA TCATTGACTC CACCACTGGT GGTTTTGAGG CTGGTATCTC CAAGGATGGC CAGACCCGTG AGCACGCTCT
TCTTGCTTTC ACTCTTGGAG TGAAGCAGAT GATCTGCTGC TGCAACAAGG TATATATCTG TAGTGTTTGG TCTTTTGTTA
TGATTGATGA GCCTAGCACT TGTTTATACA TATTTGTGAT GCTATTGCAG AAACTTTTGG TTACATAAAT GATTTACTGC
TATATTCAGT TGGAAATTGG AAATGAACAT ATTCGTGATG CTATTCCAGA TATTCTTGTT TTCTGTTATG ATTGATGAGC
AACTTCTGTG AATATTCATG ATGCTAGTCC TGAATACTGT TGATTACATC AATGAAGTAG CATTTTCTTT TATTGATTTA
TCCCTCTGTG CTAGTTTTTC TGACTGTCTA CCTTCTATGC ATCTAAGACT GCAATTTACC ATGCATCTAA GGCTGCTACT
GTTGATTGTT GCTTTTGTTA TGACTGTCTG TCTTTATGAT GCATCTAAGA TTGCAATTGT TGTTGGTTGC TTTCCTGCTA
CTACTAGCTT TAGTAATTTA CTGCTGCAAG AAACTATACA TATCTTCTGT TAGATTTGGT TAAGTTCATT TAGATATCGT
GCTGTATGTT ACTTTATACT AGACTTGTAT TGATGTTGCT GTCCACCTGT ATTTCATTAC ATATTGGTTG CTATTATTTC
ATTTTTTGTA TCTTATATGG TGTTTATAAT ATGTTTCATA CCATTTGTAG TTAGTAATGT ATTTGTATGC TGGTGCCTGC
CCCTGATTTG TTTTCCTTTG TTCTGTTACA GATGGATGCC ACCACTCCCA AGTACTCCAA GGCCCGTTAC GATGAAATCG
TGAAGGAAGT CTCATCCTAC CTGAAGAAGG TCGGCTACAA CCCTGACAAG ATTCCCTTCG TTCCCATCTC TGGGTTTGAG
GGTGACAACA TGATTGAGAG GTCCACCAAC CTTGACTGGT ACAAGGGCCC CACCTTGCTT GAGGCTCTTG ACCAGATCAA
CGAGCCCAAG AGGCCATCAG ACAAGCCCCT GCGTCTTCCC CTTCAGGACG TGTACAAGAT CGGTGGTATT GGCACCGTGC
CTGTGGGTCG TGTTGAGACT GGAGTCCTCA AGCCTGGTAT GGTGGTGACC TTTGGTCCCA GCGGCCTGAC CACTGAGGTC
AAGTCGGTTG AGATGCACCA CGAGGCTCTC CAGGAGGCTC TTCCTGGTGA CAACGTCGGG TTCAACGTGA AGAACGTTGC
GGTGAAGGAT CTGAAGCGTG GGTACGTGGC CTCCAACTCC AAGGATGACC CTGCCAAGGA GGCTGCCAGC TTCACCTCCC
AGGTGATCAT CATGAACCAC CCTGGCCAGA TCGGCAACGG CTACGCCCCA GTGCTGGACT GCCACACCTC CCACATTGCC
GTCAAGTTTG CTGAGCTGGT GACCAAGATC GACAGACGAT CTGGTAAGGA GCTGGAGAAG GAGCCCAAGT TCCTCAAGAA
CGGTGATGCT GGTATGGTTA AGATGATTCC CACCAAGCCC ATGGTTGTGG AGACCTTCTC TGAGTACCCT CCTCTTGGTC
GTTTTGCCGT GCGGGACATG AGGCAAACGG TGGCTGTTGG CGTCATCAAG AACGTGGAGA AGAAGGACCC AACCGGTGCC
AAGGTGACCA AGGCTGCCGC CAAGAAGAAA TGAGCCTCGT TCAAGTGGTG CTTTCCATAT CTGCATTTGA GATATCTAGC
TCTTTTAGTA CTCGTTAAGT TTTGTCGACG GTCATTTCAG TTGTTGCATT GACCGTTAAT ATCTGCTCGC TTTGTGCACT
ATGTCAGTCA TTTAAAACTC TATTTTCTGT TCGGTTTAAA CTTGGATGTT AAGACTTATT ATTGCC