Os03t0177400-02

Locus

Os03g0177400

Description

Similar to Elongation factor 1-alpha.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RFA1

CGSNL Gene Name

ELONGATION FACTOR 1A1

Oryzabase Gene Symbol Synonym(s)

rfa1*, REFA1, refa1, OseEF-1A, eEF-1A, Osef1a1

Oryzabase Gene Name Synonym(s)

rice elongation factor 1A (eEFIA)-1, rice elongation factor 1A-1, ELONGATION FACTOR 1A, Elongation factor 1-alpha, EF-1-alpha, eukaryotic translation elongation factor 1A

Transcript Evidence

AK062030 (DDBJ, Best hit)

Protein Evidence

Q10QZ4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: translational elongation (GO:0006414)

Cellular Component: cytoplasm (GO:0005737)

Molecular Function: translation elongation factor activity (GO:0003746)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Protein synthesis factor, GTP-binding (IPR000795)

Translation elongation factor EFTu/EF1A, C-terminal (IPR004160)

Translation elongation factor EFTu/EF1A, domain 2 (IPR004161)

Translation elongation factor EF1A, eukaryotic/archaeal (IPR004539)

Translation elongation/initiation factor/Ribosomal, beta-barrel (IPR009000)

Translation elongation factor EF1A/initiation factor IF2gamma, C-terminal (IPR009001)

Full-length cDNA

001-043-G10 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0177400-02)

RiceXPro (AK062030)

Others

Oryzabase (2069)

KEGG (Os03t0177400-02 (EC:3.6.5.3))

Transcript

1357 bp

>Os03t0177400-02 Similar to Elongation factor 1-alpha.
AGCTCAAGGCCGAGCGTGAGAGAGGTATCACCATCGATATCGCCCTGTGGAAGTTCGAGA
CCACCAAGTACTACTGCACGGTCATCGATGCCCCTGGTCACCGTGACTTCATCAAGAACA
TGATCACGGGTACCTCCCAGGCTGACTGTGCCGTGCTCATCATTGACTCCACCACTGGTG
GTTTTGAGGCTGGTATCTCCAAGGATGGCCAGACCCGTGAGCACGCTCTTCTTGCTTTCA
CTCTTGGAGTGAAGCAGATGATCTGCTGCTGCAACAAGATGGATGCCACCACTCCCAAGT
ACTCCAAGGCCCGTTACGATGAAATCGTGAAGGAAGTCTCATCCTACCTGAAGAAGGTCG
GCTACAACCCTGACAAGATTCCCTTCGTTCCCATCTCTGGGTTTGAGGGTGACAACATGA
TTGAGAGGTCCACCAACCTTGACTGGTACAAGGGCCCCACCTTGCTTGAGGCTCTTGACC
AGATCAACGAGCCCAAGAGGCCATCAGACAAGCCCCTGCGTCTTCCCCTTCAGGACGTGT
ACAAGATCGGTGGTATTGGCACCGTGCCTGTGGGTCGTGTTGAGACTGGAGTCCTCAAGC
CTGGTATGGTGGTGACCTTTGGTCCCAGCGGCCTGACCACTGAGGTCAAGTCGGTTGAGA
TGCACCACGAGGCTCTCCAGGAGGCTCTTCCTGGTGACAACGTCGGGTTCAACGTGAAGA
ACGTTGCGGTGAAGGATCTGAAGCGTGGGTACGTGGCCTCCAACTCCAAGGATGACCCTG
CCAAGGAGGCTGCCAGCTTCACCTCCCAGGTGATCATCATGAACCACCCTGGCCAGATCG
GCAACGGCTACGCCCCAGTGCTGGACTGCCACACCTCCCACATTGCCGTCAAGTTTGCTG
AGCTGGTGACCAAGATCGACAGACGATCTGGTAAGGAGCTGGAGAAGGAGCCCAAGTTCC
TCAAGAACGGTGATGCTGGTATGGTTAAGATGATTCCCACCAAGCCCATGGTTGTGGAGA
CCTTCTCTGAGTACCCTCCTCTTGGTCGTTTTGCCGTGCGGGACATGAGGCAAACGGTGG
CTGTTGGCGTCATCAAGAACGTGGAGAAGAAGGACCCAACCGGTGCCAAGGTGACCAAGG
CTGCCGCCAAGAAGAAATGAGCCTCGTTCAAGTGGTGCTTTCCATATCTGCATTTGAGAT
ATCTAGCTCTTTTAGTACTCGTTAAGTTTTGTCGACGGTCATTTCAGTTGTTGCATTGAC
CGTTAATATCTGCTCGCTTTGTGCACTATGTCAGTCATTTAAAACTCTATTTTCTGTTCG
GTTTAAACTTGGATGTTAAGACTTATTATTGCCCTTC

CDS

1158 bp

>Os03t0177400-02 Similar to Elongation factor 1-alpha.
CTCAAGGCCGAGCGTGAGAGAGGTATCACCATCGATATCGCCCTGTGGAAGTTCGAGACC
ACCAAGTACTACTGCACGGTCATCGATGCCCCTGGTCACCGTGACTTCATCAAGAACATG
ATCACGGGTACCTCCCAGGCTGACTGTGCCGTGCTCATCATTGACTCCACCACTGGTGGT
TTTGAGGCTGGTATCTCCAAGGATGGCCAGACCCGTGAGCACGCTCTTCTTGCTTTCACT
CTTGGAGTGAAGCAGATGATCTGCTGCTGCAACAAGATGGATGCCACCACTCCCAAGTAC
TCCAAGGCCCGTTACGATGAAATCGTGAAGGAAGTCTCATCCTACCTGAAGAAGGTCGGC
TACAACCCTGACAAGATTCCCTTCGTTCCCATCTCTGGGTTTGAGGGTGACAACATGATT
GAGAGGTCCACCAACCTTGACTGGTACAAGGGCCCCACCTTGCTTGAGGCTCTTGACCAG
ATCAACGAGCCCAAGAGGCCATCAGACAAGCCCCTGCGTCTTCCCCTTCAGGACGTGTAC
AAGATCGGTGGTATTGGCACCGTGCCTGTGGGTCGTGTTGAGACTGGAGTCCTCAAGCCT
GGTATGGTGGTGACCTTTGGTCCCAGCGGCCTGACCACTGAGGTCAAGTCGGTTGAGATG
CACCACGAGGCTCTCCAGGAGGCTCTTCCTGGTGACAACGTCGGGTTCAACGTGAAGAAC
GTTGCGGTGAAGGATCTGAAGCGTGGGTACGTGGCCTCCAACTCCAAGGATGACCCTGCC
AAGGAGGCTGCCAGCTTCACCTCCCAGGTGATCATCATGAACCACCCTGGCCAGATCGGC
AACGGCTACGCCCCAGTGCTGGACTGCCACACCTCCCACATTGCCGTCAAGTTTGCTGAG
CTGGTGACCAAGATCGACAGACGATCTGGTAAGGAGCTGGAGAAGGAGCCCAAGTTCCTC
AAGAACGGTGATGCTGGTATGGTTAAGATGATTCCCACCAAGCCCATGGTTGTGGAGACC
TTCTCTGAGTACCCTCCTCTTGGTCGTTTTGCCGTGCGGGACATGAGGCAAACGGTGGCT
GTTGGCGTCATCAAGAACGTGGAGAAGAAGGACCCAACCGGTGCCAAGGTGACCAAGGCT
GCCGCCAAGAAGAAATGA

Protein

386 aa

>Os03t0177400-02 Similar to Elongation factor 1-alpha.
LKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGG
FEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVG
YNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVY
KIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNVKN
VAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE
LVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVA
VGVIKNVEKKDPTGAKVTKAAAKKK*

5'UTR

chr03:4095378..4095379 (+ strand) : 2 bp

CDS

chr03:4095380..4095655 (+ strand) : 276 bp

chr03:4096358..4097239 (+ strand) : 882 bp

3'UTR

chr03:4097240..4097436 (+ strand) : 197 bp

FASTA

>Os03t0177400-02 class=Sequence position=chr03:4095378..4097436 (+ strand)
AGCTCAAGGC CGAGCGTGAG AGAGGTATCA CCATCGATAT CGCCCTGTGG AAGTTCGAGA CCACCAAGTA CTACTGCACG
GTCATCGATG CCCCTGGTCA CCGTGACTTC ATCAAGAACA TGATCACGGG TACCTCCCAG GCTGACTGTG CCGTGCTCAT
CATTGACTCC ACCACTGGTG GTTTTGAGGC TGGTATCTCC AAGGATGGCC AGACCCGTGA GCACGCTCTT CTTGCTTTCA
CTCTTGGAGT GAAGCAGATG ATCTGCTGCT GCAACAAGGT ATATATCTGT AGTGTTTGGT CTTTTGTTAT GATTGATGAG
CCTAGCACTT GTTTATACAT ATTTGTGATG CTATTGCAGA AACTTTTGGT TACATAAATG ATTTACTGCT ATATTCAGTT
GGAAATTGGA AATGAACATA TTCGTGATGC TATTCCAGAT ATTCTTGTTT TCTGTTATGA TTGATGAGCA ACTTCTGTGA
ATATTCATGA TGCTAGTCCT GAATACTGTT GATTACATCA ATGAAGTAGC ATTTTCTTTT ATTGATTTAT CCCTCTGTGC
TAGTTTTTCT GACTGTCTAC CTTCTATGCA TCTAAGACTG CAATTTACCA TGCATCTAAG GCTGCTACTG TTGATTGTTG
CTTTTGTTAT GACTGTCTGT CTTTATGATG CATCTAAGAT TGCAATTGTT GTTGGTTGCT TTCCTGCTAC TACTAGCTTT
AGTAATTTAC TGCTGCAAGA AACTATACAT ATCTTCTGTT AGATTTGGTT AAGTTCATTT AGATATCGTG CTGTATGTTA
CTTTATACTA GACTTGTATT GATGTTGCTG TCCACCTGTA TTTCATTACA TATTGGTTGC TATTATTTCA TTTTTTGTAT
CTTATATGGT GTTTATAATA TGTTTCATAC CATTTGTAGT TAGTAATGTA TTTGTATGCT GGTGCCTGCC CCTGATTTGT
TTTCCTTTGT TCTGTTACAG ATGGATGCCA CCACTCCCAA GTACTCCAAG GCCCGTTACG ATGAAATCGT GAAGGAAGTC
TCATCCTACC TGAAGAAGGT CGGCTACAAC CCTGACAAGA TTCCCTTCGT TCCCATCTCT GGGTTTGAGG GTGACAACAT
GATTGAGAGG TCCACCAACC TTGACTGGTA CAAGGGCCCC ACCTTGCTTG AGGCTCTTGA CCAGATCAAC GAGCCCAAGA
GGCCATCAGA CAAGCCCCTG CGTCTTCCCC TTCAGGACGT GTACAAGATC GGTGGTATTG GCACCGTGCC TGTGGGTCGT
GTTGAGACTG GAGTCCTCAA GCCTGGTATG GTGGTGACCT TTGGTCCCAG CGGCCTGACC ACTGAGGTCA AGTCGGTTGA
GATGCACCAC GAGGCTCTCC AGGAGGCTCT TCCTGGTGAC AACGTCGGGT TCAACGTGAA GAACGTTGCG GTGAAGGATC
TGAAGCGTGG GTACGTGGCC TCCAACTCCA AGGATGACCC TGCCAAGGAG GCTGCCAGCT TCACCTCCCA GGTGATCATC
ATGAACCACC CTGGCCAGAT CGGCAACGGC TACGCCCCAG TGCTGGACTG CCACACCTCC CACATTGCCG TCAAGTTTGC
TGAGCTGGTG ACCAAGATCG ACAGACGATC TGGTAAGGAG CTGGAGAAGG AGCCCAAGTT CCTCAAGAAC GGTGATGCTG
GTATGGTTAA GATGATTCCC ACCAAGCCCA TGGTTGTGGA GACCTTCTCT GAGTACCCTC CTCTTGGTCG TTTTGCCGTG
CGGGACATGA GGCAAACGGT GGCTGTTGGC GTCATCAAGA ACGTGGAGAA GAAGGACCCA ACCGGTGCCA AGGTGACCAA
GGCTGCCGCC AAGAAGAAAT GAGCCTCGTT CAAGTGGTGC TTTCCATATC TGCATTTGAG ATATCTAGCT CTTTTAGTAC
TCGTTAAGTT TTGTCGACGG TCATTTCAGT TGTTGCATTG ACCGTTAATA TCTGCTCGCT TTGTGCACTA TGTCAGTCAT
TTAAAACTCT ATTTTCTGTT CGGTTTAAAC TTGGATGTTA AGACTTATTA TTGCCCTTC