Os03t0177500-01

Locus

Os03g0177500

Description

EF-1 alpha.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RFA4

CGSNL Gene Name

ELONGATION FACTOR 1A4

Oryzabase Gene Symbol Synonym(s)

rfa4*, REFA4, refa4, eEF-1a, OsEF-1a, OsEF1A, EF1A, eIF-1-alpha

Oryzabase Gene Name Synonym(s)

rice elongation factor 1A (eEFIA)-4, rice elongation factor 1A-4, ELONGATION FACTOR 1A, Elongation factor 1-alpha, EF-1-alpha, Eukaryotic elongation factor 1-alpha, elongation factor 1 alpha

Transcript Evidence

AK119537 (DDBJ, Best hit)

AK061464 (DDBJ, Best hit)

Protein Evidence

B8APM5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: translational elongation (GO:0006414)

Cellular Component: cytoplasm (GO:0005737)

Molecular Function: translation elongation factor activity (GO:0003746)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Protein synthesis factor, GTP-binding (IPR000795)

Translation elongation factor EFTu/EF1A, C-terminal (IPR004160)

Translation elongation factor EFTu/EF1A, domain 2 (IPR004161)

Translation elongation factor EF1A, eukaryotic/archaeal (IPR004539)

Translation elongation/initiation factor/Ribosomal, beta-barrel (IPR009000)

Translation elongation factor EF1A/initiation factor IF2gamma, C-terminal (IPR009001)

Full-length cDNA

001-204-B11 (Online Clone Ordering)

006-308-C01 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0177500-01)

Others

Oryzabase (2072)

Transcript

1722 bp

>Os03t0177500-01 EF-1 alpha.
TCCTCTCTCCCATCTCATCCCAGCCGCCGCCGCCGCAGCCTCCTCCTCTCGCCATCTCCC
GTCCTCTCCTTCAAGTCAGCTACCTGCTTAATCAACCATGGGTAAGGAGAAGACGCACAT
CAACATTGTGGTCATTGGCCACGTCGACTCTGGCAAGTCGACCACCACGGGCCATCTGAT
CTACAAGCTTGGAGGTATCGACAAGCGTGTGATTGAGAGGTTCGAGAAGGAAGCCGCTGA
GATGAACAAGAGGTCCTTCAAGTACGCGTGGGTGCTCGACAAGCTCAAGGCCGAGCGTGA
GAGAGGTATCACCATCGATATTGCCCTGTGGAAGTTCGAGACCACCAAGTACTACTGCAC
GGTCATCGATGCCCCTGGTCACCGTGACTTCATCAAGAACATGATCACGGGTACCTCCCA
GGCTGACTGTGCCGTGCTCATCATTGACTCCACCACTGGTGGTTTTGAGGCTGGTATCTC
CAAGGATGGCCAGACCCGTGAGCACGCTCTTCTTGCTTTCACTCTTGGTGTGAAGCAGAT
GATCTGCTGCTGCAACAAGATGGATGCCACCACTCCCAAGTACTCCAAGGCCCGTTACGA
TGAAATCGTGAAGGAAGTCTCATCCTACCTGAAGAAGGTCGGCTACAACCCTGACAAGAT
TCCCTTCGTTCCCATCTCTGGGTTTGAGGGTGACAACATGATTGAGAGGTCCACCAACCT
TGACTGGTACAAGGGCCCCACCTTGCTTGAGGCTCTTGACCAGATCAACGAGCCCAAGAG
GCCATCAGACAAGCCCCTGCGTCTTCCCCTTCAGGACGTGTACAAGATCGGTGGTATTGG
CACCGTGCCTGTGGGTCGTGTTGAGACTGGAGTCCTCAAGCCTGGTATGGTGGTGACCTT
TGGTCCCAGCGGCCTGACCACTGAGGTCAAGTCGGTTGAGATGCACCACGAGGCTCTCCA
GGAGGCTCTTCCTGGTGACAACGTCGGGTTCAACGTGAAGAACGTTGCGGTGAAGGATCT
GAAGCGTGGGTACGTGGCCTCCAACTCCAAGGATGACCCTGCCAAGGAGGCTGCCAGCTT
CACCTCCCAGGTGATCATCATGAACCACCCTGGCCAGATCGGCAACGGCTACGCCCCAGT
GCTGGACTGCCACACCTCCCACATTGCCGTCAAGTTTGCTGAGCTGGTGACCAAGATCGA
CAGACGATCTGGTAAGGAGCTGGAGAAGGAGCCCAAGTTCCTCAAGAACGGTGATGCTGG
TATGGTTAAGATGATTCCCACCAAGCCCATGGTTGTGGAGACCTTCTCTGAGTACCCTCC
TCTTGGTCGTTTTGCCGTGCGTGACATGAGGCAAACGGTGGCTGTTGGCGTCATCAAGAA
CGTGGAGAAGAAGGACCCAACCGGTGCCAAGGTGACCAAGGCTGCCGCCAAGAAGAAATG
ATCCTCGTTCAAGTGGTAGTTTTGTGCACGGCCATGGCACTCGTTGCATTGACCGTTATT
ATCATATGCTCGCTGTGTGCACTGTGTCGTTTAAAACTCTCTATTTTCTGTTCGGTTTAA
ACTTGTTCTGAGCCTGATTATTGCCCTTCGGCTGTTGTGGAATGCGGGTATTTACATTGC
TAATTCCTATGTCTTTATTTTGGCTTGTGGCATTCGCTTGTTCTACTGCTATTGAAAACT
GTAATCTGTTTCTGTTATTAAAAACTGAACCTTTTCTTCTGC

CDS

1344 bp

>Os03t0177500-01 EF-1 alpha.
ATGGGTAAGGAGAAGACGCACATCAACATTGTGGTCATTGGCCACGTCGACTCTGGCAAG
TCGACCACCACGGGCCATCTGATCTACAAGCTTGGAGGTATCGACAAGCGTGTGATTGAG
AGGTTCGAGAAGGAAGCCGCTGAGATGAACAAGAGGTCCTTCAAGTACGCGTGGGTGCTC
GACAAGCTCAAGGCCGAGCGTGAGAGAGGTATCACCATCGATATTGCCCTGTGGAAGTTC
GAGACCACCAAGTACTACTGCACGGTCATCGATGCCCCTGGTCACCGTGACTTCATCAAG
AACATGATCACGGGTACCTCCCAGGCTGACTGTGCCGTGCTCATCATTGACTCCACCACT
GGTGGTTTTGAGGCTGGTATCTCCAAGGATGGCCAGACCCGTGAGCACGCTCTTCTTGCT
TTCACTCTTGGTGTGAAGCAGATGATCTGCTGCTGCAACAAGATGGATGCCACCACTCCC
AAGTACTCCAAGGCCCGTTACGATGAAATCGTGAAGGAAGTCTCATCCTACCTGAAGAAG
GTCGGCTACAACCCTGACAAGATTCCCTTCGTTCCCATCTCTGGGTTTGAGGGTGACAAC
ATGATTGAGAGGTCCACCAACCTTGACTGGTACAAGGGCCCCACCTTGCTTGAGGCTCTT
GACCAGATCAACGAGCCCAAGAGGCCATCAGACAAGCCCCTGCGTCTTCCCCTTCAGGAC
GTGTACAAGATCGGTGGTATTGGCACCGTGCCTGTGGGTCGTGTTGAGACTGGAGTCCTC
AAGCCTGGTATGGTGGTGACCTTTGGTCCCAGCGGCCTGACCACTGAGGTCAAGTCGGTT
GAGATGCACCACGAGGCTCTCCAGGAGGCTCTTCCTGGTGACAACGTCGGGTTCAACGTG
AAGAACGTTGCGGTGAAGGATCTGAAGCGTGGGTACGTGGCCTCCAACTCCAAGGATGAC
CCTGCCAAGGAGGCTGCCAGCTTCACCTCCCAGGTGATCATCATGAACCACCCTGGCCAG
ATCGGCAACGGCTACGCCCCAGTGCTGGACTGCCACACCTCCCACATTGCCGTCAAGTTT
GCTGAGCTGGTGACCAAGATCGACAGACGATCTGGTAAGGAGCTGGAGAAGGAGCCCAAG
TTCCTCAAGAACGGTGATGCTGGTATGGTTAAGATGATTCCCACCAAGCCCATGGTTGTG
GAGACCTTCTCTGAGTACCCTCCTCTTGGTCGTTTTGCCGTGCGTGACATGAGGCAAACG
GTGGCTGTTGGCGTCATCAAGAACGTGGAGAAGAAGGACCCAACCGGTGCCAAGGTGACC
AAGGCTGCCGCCAAGAAGAAATGA

Protein

448 aa

>Os03t0177500-01 EF-1 alpha.
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK
VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD
VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
AELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT
VAVGVIKNVEKKDPTGAKVTKAAAKKK*

5'UTR

chr03:4099985..4100059 (+ strand) : 75 bp

chr03:4100719..4100740 (+ strand) : 22 bp

CDS

chr03:4100741..4101202 (+ strand) : 462 bp

chr03:4101798..4102679 (+ strand) : 882 bp

3'UTR

chr03:4102680..4102960 (+ strand) : 281 bp

FASTA

>Os03t0177500-01 class=Sequence position=chr03:4099985..4102960 (+ strand)
TCCTCTCTCC CATCTCATCC CAGCCGCCGC CGCCGCAGCC TCCTCCTCTC GCCATCTCCC GTCCTCTCCT TCAAGGTCAG
CTTCAGATCT TCTCACTTAT CCTTGTTTGC GCCTGTTCAT GATCGTTCGT AGCTGCAGAT CTGGTTTGGT ATCGCGAGGT
TTGGGTGATT TGGTGCTTGG GCATGTTGTT TTCGTTCATT TTTTATTGTG TATTCGTCTC ACTGCTGTGA TCTTAGTTTG
ATGTCCGTTG ACGCGAAGAT AAACTTGATT TGTCCGCGAA TCATGTGCGT ATGTTGGAAA TTATCGGTAG AATCGAACGA
TAAACTTGAG TTACTGCATA ATCATCTACA TAAGTGGAAA ACTACTGGTA GAATCGGTAG AAAATCTGTA TCTAGAATCC
ATAATTTGTT GTTAAACTAC TGCTGAGTAG ATGTTGTTAT TGTCCGTGCC CTGTTCAGTT GGGTACTGAA ATTCTGTATC
TAAAATCCAA TCCGTAAATT TGTTTCTGTA AATTTGTTAT TGTGCTACTG CTGAGTAGAT GGTGTTATTG TCTGTACCCT
GTTCGGTTGT GTCGATTACT GCGCGTCTGT GTAAATCTCA TGCTGATTTT GATGGCTATT AACGTTCTGT GGATGTCCAA
GTGATCTGAT CTGAGATCTT GCCTGTGATA TTTATTTGGA GTTAAAAATT ATACAGAAAA TTGTTTCTAA TCTTTGTTTT
ATTACGTAGA ACAGTCAGCT ACCTGCTTAA TCAACCATGG GTAAGGAGAA GACGCACATC AACATTGTGG TCATTGGCCA
CGTCGACTCT GGCAAGTCGA CCACCACGGG CCATCTGATC TACAAGCTTG GAGGTATCGA CAAGCGTGTG ATTGAGAGGT
TCGAGAAGGA AGCCGCTGAG ATGAACAAGA GGTCCTTCAA GTACGCGTGG GTGCTCGACA AGCTCAAGGC CGAGCGTGAG
AGAGGTATCA CCATCGATAT TGCCCTGTGG AAGTTCGAGA CCACCAAGTA CTACTGCACG GTCATCGATG CCCCTGGTCA
CCGTGACTTC ATCAAGAACA TGATCACGGG TACCTCCCAG GCTGACTGTG CCGTGCTCAT CATTGACTCC ACCACTGGTG
GTTTTGAGGC TGGTATCTCC AAGGATGGCC AGACCCGTGA GCACGCTCTT CTTGCTTTCA CTCTTGGTGT GAAGCAGATG
ATCTGCTGCT GCAACAAGGT ATATATCTCT AGTGTTTTTT CTTCTGTTAT GATTGATGAG TCTAGCACTT GTTTGTTCAC
ATTCGTGATG CTATTCTAGA TACAATGAAG TAGCATAATA TGTTTTATTC ACTATGCATC TAATACTTCA ATGTTTGATT
CTTGCAAGCA TATCTGTCTT TTATGATTGA TCTGCACAGC ACTTCTGTAC ATATTCATGA CGCTTGTCCT GAATACTCTT
GATTACATCA ATGAAGTAGC TTTCATTTGA ACGTCTAGTT GTTTGTTACT TTATACTAAA CATCTATTTG ATTGGTTTAA
GTTATATTTT AAATTATCTG GTTGTGGTGT TGTACTTCAT TTTGTCATTT TTATCCTGCT GGAAGTTGCA GCCCCTGTCC
TGTTTCATTA CATCTTATCT GGTCACTGTG TATCTTATAT GCTGTTAAGT ACCTTTTGAT ACTCCTACAT CTGGTCCCTG
CTCTTGTATA TCTTATATGC TGTTTTAAGT ATTGTTTCAT ATGATCATAT CTTGTATGGT TATCTTTGTT TGGTTGCCAA
CCGACCCCCT GCTGAGGAAA GTTATTGATT TGTTTTCCTT TGTTCTGTTA CAGATGGATG CCACCACTCC CAAGTACTCC
AAGGCCCGTT ACGATGAAAT CGTGAAGGAA GTCTCATCCT ACCTGAAGAA GGTCGGCTAC AACCCTGACA AGATTCCCTT
CGTTCCCATC TCTGGGTTTG AGGGTGACAA CATGATTGAG AGGTCCACCA ACCTTGACTG GTACAAGGGC CCCACCTTGC
TTGAGGCTCT TGACCAGATC AACGAGCCCA AGAGGCCATC AGACAAGCCC CTGCGTCTTC CCCTTCAGGA CGTGTACAAG
ATCGGTGGTA TTGGCACCGT GCCTGTGGGT CGTGTTGAGA CTGGAGTCCT CAAGCCTGGT ATGGTGGTGA CCTTTGGTCC
CAGCGGCCTG ACCACTGAGG TCAAGTCGGT TGAGATGCAC CACGAGGCTC TCCAGGAGGC TCTTCCTGGT GACAACGTCG
GGTTCAACGT GAAGAACGTT GCGGTGAAGG ATCTGAAGCG TGGGTACGTG GCCTCCAACT CCAAGGATGA CCCTGCCAAG
GAGGCTGCCA GCTTCACCTC CCAGGTGATC ATCATGAACC ACCCTGGCCA GATCGGCAAC GGCTACGCCC CAGTGCTGGA
CTGCCACACC TCCCACATTG CCGTCAAGTT TGCTGAGCTG GTGACCAAGA TCGACAGACG ATCTGGTAAG GAGCTGGAGA
AGGAGCCCAA GTTCCTCAAG AACGGTGATG CTGGTATGGT TAAGATGATT CCCACCAAGC CCATGGTTGT GGAGACCTTC
TCTGAGTACC CTCCTCTTGG TCGTTTTGCC GTGCGTGACA TGAGGCAAAC GGTGGCTGTT GGCGTCATCA AGAACGTGGA
GAAGAAGGAC CCAACCGGTG CCAAGGTGAC CAAGGCTGCC GCCAAGAAGA AATGATCCTC GTTCAAGTGG TAGTTTTGTG
CACGGCCATG GCACTCGTTG CATTGACCGT TATTATCATA TGCTCGCTGT GTGCACTGTG TCGTTTAAAA CTCTCTATTT
TCTGTTCGGT TTAAACTTGT TCTGAGCCTG ATTATTGCCC TTCGGCTGTT GTGGAATGCG GGTATTTACA TTGCTAATTC
CTATGTCTTT ATTTTGGCTT GTGGCATTCG CTTGTTCTAC TGCTATTGAA AACTGTAATC TGTTTCTGTT ATTAAAAACT
GAACCTTTTC TTCTGC

Locus: Os03g0177500

Loading...

Locus: Os03g0177500

Loading...