Os03t0177900-01

Locus

Os03g0177900

Description

EF-1 alpha.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RFA3

CGSNL Gene Name

ELONGATION FACTOR 1A3

Oryzabase Gene Symbol Synonym(s)

rfa3*, REFA3, refa3

Oryzabase Gene Name Synonym(s)

rice elongation factor 1A (eEFIA)-3, rice elongation factor 1A-3, ELONGATION FACTOR 1A, Elongation factor 1-alpha, EF-1-alpha

Transcript Evidence

AK119647 (DDBJ, Best hit)

AK119528 (DDBJ, Best hit)

AK071343 (DDBJ, Best hit)

Protein Evidence

B8APM5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: translational elongation (GO:0006414)

Cellular Component: cytoplasm (GO:0005737)

Molecular Function: translation elongation factor activity (GO:0003746)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Protein synthesis factor, GTP-binding (IPR000795)

Translation elongation factor EFTu/EF1A, C-terminal (IPR004160)

Translation elongation factor EFTu/EF1A, domain 2 (IPR004161)

Translation elongation factor EF1A, eukaryotic/archaeal (IPR004539)

Translation elongation/initiation factor/Ribosomal, beta-barrel (IPR009000)

Translation elongation factor EF1A/initiation factor IF2gamma, C-terminal (IPR009001)

Full-length cDNA

002-130-G07 (Online Clone Ordering)

001-203-C04 (Online Clone Ordering)

J023091A02 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0177900-01)

Others

Oryzabase (2071)

Transcript

1660 bp

>Os03t0177900-01 EF-1 alpha.
CTCCCGTCTCACCCTAGCCGCCGCCGCCTCCTCCTCCTCTCGCCTTCTCCCGTCTTCTCC
TTCGAGTTAGCTACCTCCTTATTCAACCATGGGTAAGGAGAAGACGCACATCAACATCGT
GGTCATTGGCCACGTCGACTCCGGCAAGTCGACCACCACGGGCCATCTGATTTACAAGCT
TGGAGGTATCGACAAGCGTGTGATCGAGAGGTTCGAGAAGGAAGCCGCTGAGATGAACAA
GAGGTCCTTCAAGTACGCGTGGGTGCTTGACAAGCTCAAGGCCGAGCGTGAGAGAGGTAT
CACCATCGATATTGCCCTGTGGAAGTTCGAGACCACCAAGTACTACTGCACGGTCATCGA
TGCCCCTGGTCACCGTGACTTCATCAAGAACATGATCACGGGTACCTCCCAGGCTGACTG
TGCCGTGCTCATCATTGACTCCACCACTGGTGGTTTTGAGGCTGGTATCTCCAAGGATGG
CCAGACCCGTGAGCACGCTCTTCTTGCTTTCACTCTTGGAGTGAAGCAGATGATCTGCTG
CTGCAACAAGATGGATGCCACCACTCCCAAGTACTCCAAGGCCCGTTATGATGAAATCGT
GAAGGAAGTCTCATCCTACCTGAAGAAGGTCGGCTACAATCCTGACAAGATTCCCTTCGT
TCCCATCTCTGGGTTTGAGGGTGACAACATGATTGAGAGGTCCACCAACCTTGACTGGTA
CAAGGGCCCCACCTTGCTTGAGGCTCTTGACCAGATCAACGAGCCCAAGAGGCCATCAGA
CAAGCCCCTGCGTCTTCCCCTTCAGGACGTGTACAAGATCGGTGGTATTGGCACCGTGCC
TGTGGGTCGTGTTGAGACTGGAGTCCTCAAGCCTGGTATGGTGGTGACCTTTGGTCCCAG
TGGCCTGACCACTGAGGTCAAGTCGGTTGAGATGCACCACGAGGCTCTCCAGGAGGCTCT
TCCTGGTGACAACGTCGGGTTCAACGTGAAGAACGTTGCGGTGAAGGATCTGAAGCGTGG
GTACGTGGCCTCCAACTCCAAGGATGACCCTGCCAAGGAGGCTGCCAGCTTCACCTCCCA
GGTGATCATCATGAACCACCCTGGGCAGATCGGTAACGGCTATGCTCCAGTGCTGGACTG
CCACACCTCCCACATTGCTGTCAAGTTTGCTGAGCTGGTGACCAAGATTGACAGACGATC
TGGCAAGGAGCTGGAGAAGGAGCCCAAGTTCTTGAAGAACGGTGATGCTGGTATGGTCAA
GATGATTCCTACCAAGCCCATGGTTGTGGAGACCTTCTCTGAGTACCCTCCTCTTGGTCG
TTTTGCGGTGCGTGACATGAGGCAAACGGTGGCTGTTGGCGTCATCAAGAACGTGGAGAA
GAAGGACCCAACCGGTGCCAAGGTGACCAAGGCTGCCGCCAAGAAGAAGTGAGCCTCGTT
CAAATGGTGGTTTGCATGTCTGCAGTTGAGATATCTAGTTCTAGTATTTGTTAAGTTTTG
CCCACGGCCATGGCTCTCGTTTCATGGACCGTTAATATCTGCTCGCAATGTGCACTATGT
CAGTCGTTTAATACTCGTTTATTTCTGTTCGGTTAAAACTGATGCTCTGAGTCCGATTAT
TGTCCATCGGCTGTTTTGGAATGCGAGTATTTACATTGCT

CDS

1344 bp

>Os03t0177900-01 EF-1 alpha.
ATGGGTAAGGAGAAGACGCACATCAACATCGTGGTCATTGGCCACGTCGACTCCGGCAAG
TCGACCACCACGGGCCATCTGATTTACAAGCTTGGAGGTATCGACAAGCGTGTGATCGAG
AGGTTCGAGAAGGAAGCCGCTGAGATGAACAAGAGGTCCTTCAAGTACGCGTGGGTGCTT
GACAAGCTCAAGGCCGAGCGTGAGAGAGGTATCACCATCGATATTGCCCTGTGGAAGTTC
GAGACCACCAAGTACTACTGCACGGTCATCGATGCCCCTGGTCACCGTGACTTCATCAAG
AACATGATCACGGGTACCTCCCAGGCTGACTGTGCCGTGCTCATCATTGACTCCACCACT
GGTGGTTTTGAGGCTGGTATCTCCAAGGATGGCCAGACCCGTGAGCACGCTCTTCTTGCT
TTCACTCTTGGAGTGAAGCAGATGATCTGCTGCTGCAACAAGATGGATGCCACCACTCCC
AAGTACTCCAAGGCCCGTTATGATGAAATCGTGAAGGAAGTCTCATCCTACCTGAAGAAG
GTCGGCTACAATCCTGACAAGATTCCCTTCGTTCCCATCTCTGGGTTTGAGGGTGACAAC
ATGATTGAGAGGTCCACCAACCTTGACTGGTACAAGGGCCCCACCTTGCTTGAGGCTCTT
GACCAGATCAACGAGCCCAAGAGGCCATCAGACAAGCCCCTGCGTCTTCCCCTTCAGGAC
GTGTACAAGATCGGTGGTATTGGCACCGTGCCTGTGGGTCGTGTTGAGACTGGAGTCCTC
AAGCCTGGTATGGTGGTGACCTTTGGTCCCAGTGGCCTGACCACTGAGGTCAAGTCGGTT
GAGATGCACCACGAGGCTCTCCAGGAGGCTCTTCCTGGTGACAACGTCGGGTTCAACGTG
AAGAACGTTGCGGTGAAGGATCTGAAGCGTGGGTACGTGGCCTCCAACTCCAAGGATGAC
CCTGCCAAGGAGGCTGCCAGCTTCACCTCCCAGGTGATCATCATGAACCACCCTGGGCAG
ATCGGTAACGGCTATGCTCCAGTGCTGGACTGCCACACCTCCCACATTGCTGTCAAGTTT
GCTGAGCTGGTGACCAAGATTGACAGACGATCTGGCAAGGAGCTGGAGAAGGAGCCCAAG
TTCTTGAAGAACGGTGATGCTGGTATGGTCAAGATGATTCCTACCAAGCCCATGGTTGTG
GAGACCTTCTCTGAGTACCCTCCTCTTGGTCGTTTTGCGGTGCGTGACATGAGGCAAACG
GTGGCTGTTGGCGTCATCAAGAACGTGGAGAAGAAGGACCCAACCGGTGCCAAGGTGACC
AAGGCTGCCGCCAAGAAGAAGTGA

Protein

448 aa

>Os03t0177900-01 EF-1 alpha.
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK
VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD
VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
AELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT
VAVGVIKNVEKKDPTGAKVTKAAAKKK*

5'UTR

chr03:4110375..4110440 (+ strand) : 66 bp

chr03:4111387..4111408 (+ strand) : 22 bp

CDS

chr03:4111409..4111870 (+ strand) : 462 bp

chr03:4112480..4113361 (+ strand) : 882 bp

3'UTR

chr03:4113362..4113589 (+ strand) : 228 bp

FASTA

>Os03t0177900-01 class=Sequence position=chr03:4110375..4113589 (+ strand)
CTCCCGTCTC ACCCTAGCCG CCGCCGCCTC CTCCTCCTCT CGCCTTCTCC CGTCTTCTCC TTCGAGGTCA GCTTCCGATC
TTCTCTCTTC TCCATGTTTG CGCCTGTTCA TGATCGTTCG TAGCTGCAGA TCTGGTTTGG TACCGCGAGG TTTGGGTGAT
TTGGTTCTTG GGCATGTTGT TTTCGTTCAT TTTTTAGTAT TTTTTTGTGT GTATTCGTCT CACTGCTATG ATCTTAGTTT
GCTGTTCGTT GAAGCGACAA TAAACTTGAT TTGTCCGCGA ATCATCTGCA TAGGTTGAAA ATTATCGGTA GAATCGAACG
ATAAACTTGA TTTGATGTGG AATAATCTAC ATAAGTTGAA AATTGTCGGT AGAATCAGTA GAAGGATTTG TATCTACAAT
CCGTTCGCTT AGATCTCTTC CTATGTTTCT GTATTTTTTT ATTCTACTAC GGCTGATTAG ATGCTGTTAT AGTCTGTAGC
CTGTTCGGTC CGGTCGATTA CTGCGCGTCT GTGTTATTCT CCTGCCGATT AACTGATTTA GCACTTTGAT AGTTGTCGAA
GTTTGAATTA GGTACCTACT TTGATAGATG CCCAACTTTT TTGTGTGTAT TCGTCTCACT ACTATGATAT TCGTCTGCTG
TTCGCTGACG CGAAGATAAA CTTGATTTGT TGGTCAATCG GTAGAATTGG ATGATGAACT TGATTTGTTG CATAATCTAG
ACAAGTTGAA AAATATCGGT TGAATTGTTG GAAGATTTGT GTCTATAATC CGTTTGCATA GACCTAGAGC TTAGTTTCTG
TTCTGTTTTT TATTCTACTA CTGCTGCTGA GTAGATGCTG TTATCGTCTC TACCTGTTTC AATTGGGTTT ATTACTGTCC
GTCTGTGTAA TTCCTTCACT GATTTTGATG CCCATTAACT ATGTTAGCAC TTTGTTAGAT TAAGTAACCT GATCTGTGAG
CTTACCTGTA ATATTTATTT GTTTCTAATC TTTGTTTCAT TCTATGCCGC AGTTAGCTAC CTCCTTATTC AACCATGGGT
AAGGAGAAGA CGCACATCAA CATCGTGGTC ATTGGCCACG TCGACTCCGG CAAGTCGACC ACCACGGGCC ATCTGATTTA
CAAGCTTGGA GGTATCGACA AGCGTGTGAT CGAGAGGTTC GAGAAGGAAG CCGCTGAGAT GAACAAGAGG TCCTTCAAGT
ACGCGTGGGT GCTTGACAAG CTCAAGGCCG AGCGTGAGAG AGGTATCACC ATCGATATTG CCCTGTGGAA GTTCGAGACC
ACCAAGTACT ACTGCACGGT CATCGATGCC CCTGGTCACC GTGACTTCAT CAAGAACATG ATCACGGGTA CCTCCCAGGC
TGACTGTGCC GTGCTCATCA TTGACTCCAC CACTGGTGGT TTTGAGGCTG GTATCTCCAA GGATGGCCAG ACCCGTGAGC
ACGCTCTTCT TGCTTTCACT CTTGGAGTGA AGCAGATGAT CTGCTGCTGC AACAAGGTAT ATCTCTAGTG TTCGGTCTTT
TGTTATGATT GATTAGCCTT GCACAAGTAG CATAATCTGT TTTCTTCACT ATGCATCTAA TACTTCAATT GTTGATGCTT
GCATCTCTCT ACTGTTTGTC TTATTTTATT ATTGATCTGC ACAGCACTTC TGTACATATT CATGATGCTA GTCCTGAATA
CTGTTGATTA CAACAATGAA GTAGCATTAT GTTTGTATGG ATTTATCCCT ATATTTGCTT TTTTTTTATC TTCACTACGC
TTTTGCGCAT CTTCTAAGAC TGCAATTATT GTTGTTTGCT TTTGTTATTA CTGTCTGTCT TCACTATGAA TCCAAGAGTG
GAATTGCTGA TGGTTGCTGT CCTGCTACTA CTAGCATTAG TGATTTACCT GTTCATTCAG ATATCTAGTT GTTTTTTACT
TTATGCTAGA CTTCTATTGA AGTTGCAGCT TGCCCCTGTT TCATTACATC TTATATCTGG TCACTACTTT TTTGTGTATC
TTAGATGCTA GTATTAATTT TTTTTGTTTC ATATCATGTA TAGTTAGTTA TCTGTGTTTG TTTGCTAGTC CCTGCCCCTA
ATTCGTTTGC TTATTTCTGT TACAGATGGA TGCCACCACT CCCAAGTACT CCAAGGCCCG TTATGATGAA ATCGTGAAGG
AAGTCTCATC CTACCTGAAG AAGGTCGGCT ACAATCCTGA CAAGATTCCC TTCGTTCCCA TCTCTGGGTT TGAGGGTGAC
AACATGATTG AGAGGTCCAC CAACCTTGAC TGGTACAAGG GCCCCACCTT GCTTGAGGCT CTTGACCAGA TCAACGAGCC
CAAGAGGCCA TCAGACAAGC CCCTGCGTCT TCCCCTTCAG GACGTGTACA AGATCGGTGG TATTGGCACC GTGCCTGTGG
GTCGTGTTGA GACTGGAGTC CTCAAGCCTG GTATGGTGGT GACCTTTGGT CCCAGTGGCC TGACCACTGA GGTCAAGTCG
GTTGAGATGC ACCACGAGGC TCTCCAGGAG GCTCTTCCTG GTGACAACGT CGGGTTCAAC GTGAAGAACG TTGCGGTGAA
GGATCTGAAG CGTGGGTACG TGGCCTCCAA CTCCAAGGAT GACCCTGCCA AGGAGGCTGC CAGCTTCACC TCCCAGGTGA
TCATCATGAA CCACCCTGGG CAGATCGGTA ACGGCTATGC TCCAGTGCTG GACTGCCACA CCTCCCACAT TGCTGTCAAG
TTTGCTGAGC TGGTGACCAA GATTGACAGA CGATCTGGCA AGGAGCTGGA GAAGGAGCCC AAGTTCTTGA AGAACGGTGA
TGCTGGTATG GTCAAGATGA TTCCTACCAA GCCCATGGTT GTGGAGACCT TCTCTGAGTA CCCTCCTCTT GGTCGTTTTG
CGGTGCGTGA CATGAGGCAA ACGGTGGCTG TTGGCGTCAT CAAGAACGTG GAGAAGAAGG ACCCAACCGG TGCCAAGGTG
ACCAAGGCTG CCGCCAAGAA GAAGTGAGCC TCGTTCAAAT GGTGGTTTGC ATGTCTGCAG TTGAGATATC TAGTTCTAGT
ATTTGTTAAG TTTTGCCCAC GGCCATGGCT CTCGTTTCAT GGACCGTTAA TATCTGCTCG CAATGTGCAC TATGTCAGTC
GTTTAATACT CGTTTATTTC TGTTCGGTTA AAACTGATGC TCTGAGTCCG ATTATTGTCC ATCGGCTGTT TTGGAATGCG
AGTATTTACA TTGCT

Locus: Os03g0177900

Loading...

Locus: Os03g0177900

Loading...