Os03t0177900-02

Locus

Os03g0177900

Description

Similar to Elongation factor 1-alpha.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RFA3

CGSNL Gene Name

ELONGATION FACTOR 1A3

Oryzabase Gene Symbol Synonym(s)

rfa3*, REFA3, refa3

Oryzabase Gene Name Synonym(s)

rice elongation factor 1A (eEFIA)-3, rice elongation factor 1A-3, ELONGATION FACTOR 1A, Elongation factor 1-alpha, EF-1-alpha

Transcript Evidence

AK119194 (DDBJ, Best hit)

Protein Evidence

Q10QZ4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Translation elongation factor EFTu/EF1A, C-terminal (IPR004160)

Translation elongation factor EFTu/EF1A, domain 2 (IPR004161)

Translation elongation/initiation factor/Ribosomal, beta-barrel (IPR009000)

Translation elongation factor EF1A/initiation factor IF2gamma, C-terminal (IPR009001)

Full-length cDNA

001-041-C03 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0177900-02)

Others

Oryzabase (2071)

KEGG (Os03t0177900-02 (EC:3.6.5.3))

Transcript

1115 bp

>Os03t0177900-02 Similar to Elongation factor 1-alpha.
AGATGGATGCCACCACTCCCAAGTACTCCAAGGCCCGTTATGATGAAATCGTGAAGGAAG
TCTCATCCTACCTGAAGAAGGTCGGCTACAATCCTGACAAGATTCCCTTCGTTCCCATCT
CTGGGTTTGAGGGTGACAACATGATTGAGAGGTCCACCAACCTTGACTGGTACAAGGGCC
CCACCTTGCTTGAGGCTCTTGACCAGATCAACGAGCCCAAGAGGCCATCAGACAAGCCCC
TGCGTCTTCCCCTTCAGGACGTGTACAAGATCGGTGGTATTGGCACCGTGCCTGTGGGTC
GTGTTGAGACTGGAGTCCTCAAGCCTGGTATGGTGGTGACCTTTGGTCCCAGTGGCCTGA
CCACTGAGGTCAAGTCGGTTGAGATGCACCACGAGGCTCTCCAGGAGGCTCTTCCTGGTG
ACAACGTCGGGTTCAACGTGAAGAACGTTGCGGTGAAGGATCTGAAGCGTGGGTACGTGG
CCTCCAACTCCAAGGATGACCCTGCCAAGGAGGCTGCCAGCTTCACCTCCCAGGTGATCA
TCATGAACCACCCTGGGCAGATCGGTAACGGCTATGCTCCAGTGCTGGACTGCCACACCT
CCCACATTGCTGTCAAGTTTGCTGAGCTGGTGACCAAGATTGACAGACGATCTGGCAAGG
AGCTGGAGAAGGAGCCCAAGTTCTTGAAGAACGGTGATGCTGGTATGGTCAAGATGATTC
CTACCAAGCCCATGGTTGTGGAGACCTTCTCTGAGTACCCTCCTCTTGGTCGTTTTGCGG
TGCGTGACATGAGGCAAACGGTGGCTGTTGGCGTCATCAAGAACGTGGAGAAGAAGGACC
CAACCGGTGCCAAGGTGACCAAGGCTGCCGCCAAGAAGAAGTGAGCCTCGTTCAAATGGT
GGTTTGCATGTCTGCAGTTGAGATATCTAGTTCTAGTATTTGTTAAGTTTTGCCCACGGC
CATGGCTCTCGTTTCATGGACCGTTAATATCTGCTCGCAATGTGCACTATGTCAGTCGTT
TAATACTCGTTTATTTCTGTTCGGTTAAAACTGATGCTCTGAGTCCGATTATTGTCCATC
GGCTGTTTTGGAATGCGAGTATTTACATTGCTACT

CDS

882 bp

>Os03t0177900-02 Similar to Elongation factor 1-alpha.
ATGGATGCCACCACTCCCAAGTACTCCAAGGCCCGTTATGATGAAATCGTGAAGGAAGTC
TCATCCTACCTGAAGAAGGTCGGCTACAATCCTGACAAGATTCCCTTCGTTCCCATCTCT
GGGTTTGAGGGTGACAACATGATTGAGAGGTCCACCAACCTTGACTGGTACAAGGGCCCC
ACCTTGCTTGAGGCTCTTGACCAGATCAACGAGCCCAAGAGGCCATCAGACAAGCCCCTG
CGTCTTCCCCTTCAGGACGTGTACAAGATCGGTGGTATTGGCACCGTGCCTGTGGGTCGT
GTTGAGACTGGAGTCCTCAAGCCTGGTATGGTGGTGACCTTTGGTCCCAGTGGCCTGACC
ACTGAGGTCAAGTCGGTTGAGATGCACCACGAGGCTCTCCAGGAGGCTCTTCCTGGTGAC
AACGTCGGGTTCAACGTGAAGAACGTTGCGGTGAAGGATCTGAAGCGTGGGTACGTGGCC
TCCAACTCCAAGGATGACCCTGCCAAGGAGGCTGCCAGCTTCACCTCCCAGGTGATCATC
ATGAACCACCCTGGGCAGATCGGTAACGGCTATGCTCCAGTGCTGGACTGCCACACCTCC
CACATTGCTGTCAAGTTTGCTGAGCTGGTGACCAAGATTGACAGACGATCTGGCAAGGAG
CTGGAGAAGGAGCCCAAGTTCTTGAAGAACGGTGATGCTGGTATGGTCAAGATGATTCCT
ACCAAGCCCATGGTTGTGGAGACCTTCTCTGAGTACCCTCCTCTTGGTCGTTTTGCGGTG
CGTGACATGAGGCAAACGGTGGCTGTTGGCGTCATCAAGAACGTGGAGAAGAAGGACCCA
ACCGGTGCCAAGGTGACCAAGGCTGCCGCCAAGAAGAAGTGA

Protein

294 aa

>Os03t0177900-02 Similar to Elongation factor 1-alpha.
MDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGP
TLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLT
TEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVII
MNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIP
TKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTGAKVTKAAAKKK*

5'UTR

chr03:4112478..4112479 (+ strand) : 2 bp

CDS

chr03:4112480..4113361 (+ strand) : 882 bp

3'UTR

chr03:4113362..4113592 (+ strand) : 231 bp

FASTA

>Os03t0177900-02 class=Sequence position=chr03:4112478..4113592 (+ strand)
AGATGGATGC CACCACTCCC AAGTACTCCA AGGCCCGTTA TGATGAAATC GTGAAGGAAG TCTCATCCTA CCTGAAGAAG
GTCGGCTACA ATCCTGACAA GATTCCCTTC GTTCCCATCT CTGGGTTTGA GGGTGACAAC ATGATTGAGA GGTCCACCAA
CCTTGACTGG TACAAGGGCC CCACCTTGCT TGAGGCTCTT GACCAGATCA ACGAGCCCAA GAGGCCATCA GACAAGCCCC
TGCGTCTTCC CCTTCAGGAC GTGTACAAGA TCGGTGGTAT TGGCACCGTG CCTGTGGGTC GTGTTGAGAC TGGAGTCCTC
AAGCCTGGTA TGGTGGTGAC CTTTGGTCCC AGTGGCCTGA CCACTGAGGT CAAGTCGGTT GAGATGCACC ACGAGGCTCT
CCAGGAGGCT CTTCCTGGTG ACAACGTCGG GTTCAACGTG AAGAACGTTG CGGTGAAGGA TCTGAAGCGT GGGTACGTGG
CCTCCAACTC CAAGGATGAC CCTGCCAAGG AGGCTGCCAG CTTCACCTCC CAGGTGATCA TCATGAACCA CCCTGGGCAG
ATCGGTAACG GCTATGCTCC AGTGCTGGAC TGCCACACCT CCCACATTGC TGTCAAGTTT GCTGAGCTGG TGACCAAGAT
TGACAGACGA TCTGGCAAGG AGCTGGAGAA GGAGCCCAAG TTCTTGAAGA ACGGTGATGC TGGTATGGTC AAGATGATTC
CTACCAAGCC CATGGTTGTG GAGACCTTCT CTGAGTACCC TCCTCTTGGT CGTTTTGCGG TGCGTGACAT GAGGCAAACG
GTGGCTGTTG GCGTCATCAA GAACGTGGAG AAGAAGGACC CAACCGGTGC CAAGGTGACC AAGGCTGCCG CCAAGAAGAA
GTGAGCCTCG TTCAAATGGT GGTTTGCATG TCTGCAGTTG AGATATCTAG TTCTAGTATT TGTTAAGTTT TGCCCACGGC
CATGGCTCTC GTTTCATGGA CCGTTAATAT CTGCTCGCAA TGTGCACTAT GTCAGTCGTT TAATACTCGT TTATTTCTGT
TCGGTTAAAA CTGATGCTCT GAGTCCGATT ATTGTCCATC GGCTGTTTTG GAATGCGAGT ATTTACATTG CTACT

Locus: Os03g0177900

Loading...

Locus: Os03g0177900

Loading...