Os03t0178000-01

Locus

Os03g0178000

Description

EF-1 alpha.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RFA2

CGSNL Gene Name

ELONGATION FACTOR 1A2

Oryzabase Gene Symbol Synonym(s)

rfa2*, REFA2, refa2, OsEF1alpna, EF1alpna

Oryzabase Gene Name Synonym(s)

rice elongation factor 1A (eEFIA)-2, rice elongation factor 1A-2, ELONGATION FACTOR 1A, Elongation factor 1-alpha, EF-1-alpha

Transcript Evidence

AK072285 (DDBJ, Best hit)

Protein Evidence

B8APM5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: translational elongation (GO:0006414)

Cellular Component: cytoplasm (GO:0005737)

Molecular Function: translation elongation factor activity (GO:0003746)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Protein synthesis factor, GTP-binding (IPR000795)

Translation elongation factor EFTu/EF1A, C-terminal (IPR004160)

Translation elongation factor EFTu/EF1A, domain 2 (IPR004161)

Translation elongation factor EF1A, eukaryotic/archaeal (IPR004539)

Translation elongation/initiation factor/Ribosomal, beta-barrel (IPR009000)

Translation elongation factor EF1A/initiation factor IF2gamma, C-terminal (IPR009001)

Full-length cDNA

J023016F09 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0178000-01)

Others

Oryzabase (2070)

KEGG (Os03t0178000-01 (EC:3.6.5.3))

Transcript

1651 bp

>Os03t0178000-01 EF-1 alpha.
ccgtctcatcccagccgccgccgccgcagcctcctcctctcgtcttctccttcGAGTTGT
TAGCTCCCTCCTTATTCAACCATGGGTAAGGAGAAGACGCACATCAACATTGTGGTCATT
GGCCACGTCGACTCCGGCAAGTCGACCACCACGGGCCATCTGATCTACAAGCTTGGAGGT
ATCGACAAGCGTGTGATCGAGAGGTTCGAGAAGGAAGCCGCTGAGATGAACAAGAGGTCC
TTCAAGTACGCGTGGGTGCTCGACAAGCTCAAGGCCGAGCGTGAGAGAGGTATCACCATT
GATATCGCCCTGTGGAAGTTCGAGACCACCAAGTACTACTGCACGGTCATCGATGCCCCT
GGTCACCGTGACTTCATCAAGAACATGATCACGGGTACCTCCCAGGCTGACTGTGCCGTG
CTCATCATTGACTCCACCACTGGTGGTTTTGAGGCTGGTATCTCCAAGGATGGCCAGACC
CGTGAGCACGCTCTTCTTGCTTTCACTCTTGGAGTGAAGCAGATGATCTGCTGCTGCAAC
AAGATGGATGCCACCACTCCCAAGTACTCCAAGGCCCGTTATGATGAAATCGTGAAGGAA
GTCTCATCCTACCTGAAGAAGGTCGGCTACAACCCTGACAAGATTCCCTTTGTTCCCATC
TCTGGGTTTGAGGGTGACAACATGATTGAGAGGTCCACCAACCTTGACTGGTACAAGGGC
CCCACCTTGCTTGAGGCTCTTGACCAGATCAACGAGCCCAAGAGGCCATCAGACAAGCCC
CTACGTCTTCCCCTTCAGGACGTGTACAAGATCGGCGGTATTGGTACCGTGCCTGTGGGT
CGTGTTGAGACTGGTGTCCTCAAGCCTGGTATGGTGGTGACCTTTGGTCCCAGCGGTCTG
ACCACTGAGGTCAAGTCGGTTGAGATGCACCACGAGGCTCTCCAGGAGGCTCTTCCTGGT
GACAACGTTGGGTTCAACGTGAAGAACGTTGCCGTGAAGGATCTGAAGCGTGGGTACGTG
GCCTCTAACTCCAAGGATGACCCTGCCAAGGAGGCTGCCAGCTTCACCTCCCAGGTGATC
ATCATGAACCACCCTGGGCAGATCGGCAATGGCTACGCCCCAGTGCTGGACTGCCACACC
TCACACATTGCCGTCAAGTTTGCTGAGCTGGTGACCAAGATCGACAGACGATCCGGCAAG
GAGCTGGAGAAGGAGCCCAAGTTCCTCAAGAACGGTGATGCTGGTATGGTTAAGATGATT
CCCACCAAGCCCATGGTTGTGGAGACCTTCTCTGAGTACCCTCCTCTTGGTCGTTTTGCC
GTGCGTGACATGAGGCAAACGGTGGCTGTTGGCGTCATCAAGAACGTGGAGAAGAAGGAC
CCAACCGGTGCCAAGGTGACCAAGGCTGCCGCCAAGAAGAAATGAGCATCGTTGAAGTGG
TGGTTATGCTGGCTGCATTTGAGATATCTTAGCGTTCGTTAAGTTTTGCCCACGGCCATG
GCACTCGTTGCATGGACCGTTAATATCTGCTCGCAATGTGCACTATGTTAGTCGTTTAAA
ACTCGTTTATTTCTATTCGGTTAAAAACTTGGATGCTCTGAGTCTTATTGTTGCCCTTCG
GTTGTTGTGGAATGCGAGTACTTACAGTGCT

CDS

1344 bp

>Os03t0178000-01 EF-1 alpha.
ATGGGTAAGGAGAAGACGCACATCAACATTGTGGTCATTGGCCACGTCGACTCCGGCAAG
TCGACCACCACGGGCCATCTGATCTACAAGCTTGGAGGTATCGACAAGCGTGTGATCGAG
AGGTTCGAGAAGGAAGCCGCTGAGATGAACAAGAGGTCCTTCAAGTACGCGTGGGTGCTC
GACAAGCTCAAGGCCGAGCGTGAGAGAGGTATCACCATTGATATCGCCCTGTGGAAGTTC
GAGACCACCAAGTACTACTGCACGGTCATCGATGCCCCTGGTCACCGTGACTTCATCAAG
AACATGATCACGGGTACCTCCCAGGCTGACTGTGCCGTGCTCATCATTGACTCCACCACT
GGTGGTTTTGAGGCTGGTATCTCCAAGGATGGCCAGACCCGTGAGCACGCTCTTCTTGCT
TTCACTCTTGGAGTGAAGCAGATGATCTGCTGCTGCAACAAGATGGATGCCACCACTCCC
AAGTACTCCAAGGCCCGTTATGATGAAATCGTGAAGGAAGTCTCATCCTACCTGAAGAAG
GTCGGCTACAACCCTGACAAGATTCCCTTTGTTCCCATCTCTGGGTTTGAGGGTGACAAC
ATGATTGAGAGGTCCACCAACCTTGACTGGTACAAGGGCCCCACCTTGCTTGAGGCTCTT
GACCAGATCAACGAGCCCAAGAGGCCATCAGACAAGCCCCTACGTCTTCCCCTTCAGGAC
GTGTACAAGATCGGCGGTATTGGTACCGTGCCTGTGGGTCGTGTTGAGACTGGTGTCCTC
AAGCCTGGTATGGTGGTGACCTTTGGTCCCAGCGGTCTGACCACTGAGGTCAAGTCGGTT
GAGATGCACCACGAGGCTCTCCAGGAGGCTCTTCCTGGTGACAACGTTGGGTTCAACGTG
AAGAACGTTGCCGTGAAGGATCTGAAGCGTGGGTACGTGGCCTCTAACTCCAAGGATGAC
CCTGCCAAGGAGGCTGCCAGCTTCACCTCCCAGGTGATCATCATGAACCACCCTGGGCAG
ATCGGCAATGGCTACGCCCCAGTGCTGGACTGCCACACCTCACACATTGCCGTCAAGTTT
GCTGAGCTGGTGACCAAGATCGACAGACGATCCGGCAAGGAGCTGGAGAAGGAGCCCAAG
TTCCTCAAGAACGGTGATGCTGGTATGGTTAAGATGATTCCCACCAAGCCCATGGTTGTG
GAGACCTTCTCTGAGTACCCTCCTCTTGGTCGTTTTGCCGTGCGTGACATGAGGCAAACG
GTGGCTGTTGGCGTCATCAAGAACGTGGAGAAGAAGGACCCAACCGGTGCCAAGGTGACC
AAGGCTGCCGCCAAGAAGAAATGA

Protein

448 aa

>Os03t0178000-01 EF-1 alpha.
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK
VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD
VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
AELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT
VAVGVIKNVEKKDPTGAKVTKAAAKKK*

5'UTR

chr03:4116932..4116987 (+ strand) : 56 bp

chr03:4117574..4117598 (+ strand) : 25 bp

CDS

chr03:4117599..4118060 (+ strand) : 462 bp

chr03:4118648..4119529 (+ strand) : 882 bp

3'UTR

chr03:4119530..4119755 (+ strand) : 226 bp

FASTA

>Os03t0178000-01 class=Sequence position=chr03:4116932..4119755 (+ strand)
ccgtctcatc ccagccgccg ccgccgcagc ctcctcctct cgtcttctcc ttcGAGGTCA GCTTCAGATC TTCTCTCTTC
TCCATATTTG CGCTTGTTCA TGTTCGTTCG TAGCTGCAGA TCTGGTTTAG TAACGTGAGG TTTCGGTGAT TTCGAGCTGG
GGCATGTTGT GTTCGCCCAT TTTTTGTAAC TTTTTTCTGT GTATTCATCT CACTGCAATG ATCTTCGTCT GCTGTTCGTT
GACGCGACGA TAAACTTGAT TTGTCAGTGA ATCATCTGCA TAGGTTGAAA ATTATCGGCA GAATCGGACG ATGAACTTGA
TTTGGTGCAG AATCATTTAC ATAAGTTGAA AATTATCGGT GGAATCACTA GAAGGATTTT TATCTACAAT CCGTTCGCAT
AGATCTCTTT CCGTGTTTCT GTAATTTTTT TTATTCTACT ACTGCTGAGT AGATGTTATC GTCTGTACCC GGTTTGGTTG
GGTCGATTAC TGCGCCTCTG TGCAAATCAT CCGCCGATTA GCTGCGTTAG CACTTTTATA GCTGCCCAAG TTTGATCTGT
GAGCTTGCCT GCTATATTTA TTTAGAGTTG TAAATTATAC ACTTATCTTT GTTTCTAATA TTTGTTTCGT TCTGTGCTGC
AGTTGTTAGC TCCCTCCTTA TTCAACCATG GGTAAGGAGA AGACGCACAT CAACATTGTG GTCATTGGCC ACGTCGACTC
CGGCAAGTCG ACCACCACGG GCCATCTGAT CTACAAGCTT GGAGGTATCG ACAAGCGTGT GATCGAGAGG TTCGAGAAGG
AAGCCGCTGA GATGAACAAG AGGTCCTTCA AGTACGCGTG GGTGCTCGAC AAGCTCAAGG CCGAGCGTGA GAGAGGTATC
ACCATTGATA TCGCCCTGTG GAAGTTCGAG ACCACCAAGT ACTACTGCAC GGTCATCGAT GCCCCTGGTC ACCGTGACTT
CATCAAGAAC ATGATCACGG GTACCTCCCA GGCTGACTGT GCCGTGCTCA TCATTGACTC CACCACTGGT GGTTTTGAGG
CTGGTATCTC CAAGGATGGC CAGACCCGTG AGCACGCTCT TCTTGCTTTC ACTCTTGGAG TGAAGCAGAT GATCTGCTGC
TGCAACAAGG TATATCTCTA GTGTTCGGTC TTTTGTTATG ATTGTTGAGC CTAGCACTTG TTTGTACATA TTCGTGATGC
TATTCTAGAT ACAATGAAGT CGCATAATCT GTTTTATTCA CTATGCATCT AATACTTCAA TGTTTGATTC TTGCATATCT
GTCTTCTTTT ATGATTGATC TGCACAGCAC TTCTGTACAT ATTCGTGATG CTTGTCCTGA ATACTCTTGA TTACATCAAT
GAAGTAGCTT TCATTTGAAC GTCTAGTTGT TTGTTACTTT ATACTAAGCA TCTATTTGAT TGGTTTAGGT TATATTTTAA
ATTATCTGGT TGTGGTGTTG TACTTCATTT TGTCATTTTT ATCCTGCTGG AAGTTGCAGC CCCTGTCCTG TTTCATTACA
TCTTATCTGG TCACTGTGTA TCTTATATGC TGTTAAGTAC CTTTTGATAC TCCTACATCT GGTCCCTGCT CTTGTATATC
TTATATGCTG TTTTAAGTAT TGTTTCATAT GATCATATCT TGTATGGTTA TCTTTGTTTG GTTGCCAACT GACCCCCTGC
TGAGGAAAGT TATTGTTTTC CTTTGTTCTG TTACAGATGG ATGCCACCAC TCCCAAGTAC TCCAAGGCCC GTTATGATGA
AATCGTGAAG GAAGTCTCAT CCTACCTGAA GAAGGTCGGC TACAACCCTG ACAAGATTCC CTTTGTTCCC ATCTCTGGGT
TTGAGGGTGA CAACATGATT GAGAGGTCCA CCAACCTTGA CTGGTACAAG GGCCCCACCT TGCTTGAGGC TCTTGACCAG
ATCAACGAGC CCAAGAGGCC ATCAGACAAG CCCCTACGTC TTCCCCTTCA GGACGTGTAC AAGATCGGCG GTATTGGTAC
CGTGCCTGTG GGTCGTGTTG AGACTGGTGT CCTCAAGCCT GGTATGGTGG TGACCTTTGG TCCCAGCGGT CTGACCACTG
AGGTCAAGTC GGTTGAGATG CACCACGAGG CTCTCCAGGA GGCTCTTCCT GGTGACAACG TTGGGTTCAA CGTGAAGAAC
GTTGCCGTGA AGGATCTGAA GCGTGGGTAC GTGGCCTCTA ACTCCAAGGA TGACCCTGCC AAGGAGGCTG CCAGCTTCAC
CTCCCAGGTG ATCATCATGA ACCACCCTGG GCAGATCGGC AATGGCTACG CCCCAGTGCT GGACTGCCAC ACCTCACACA
TTGCCGTCAA GTTTGCTGAG CTGGTGACCA AGATCGACAG ACGATCCGGC AAGGAGCTGG AGAAGGAGCC CAAGTTCCTC
AAGAACGGTG ATGCTGGTAT GGTTAAGATG ATTCCCACCA AGCCCATGGT TGTGGAGACC TTCTCTGAGT ACCCTCCTCT
TGGTCGTTTT GCCGTGCGTG ACATGAGGCA AACGGTGGCT GTTGGCGTCA TCAAGAACGT GGAGAAGAAG GACCCAACCG
GTGCCAAGGT GACCAAGGCT GCCGCCAAGA AGAAATGAGC ATCGTTGAAG TGGTGGTTAT GCTGGCTGCA TTTGAGATAT
CTTAGCGTTC GTTAAGTTTT GCCCACGGCC ATGGCACTCG TTGCATGGAC CGTTAATATC TGCTCGCAAT GTGCACTATG
TTAGTCGTTT AAAACTCGTT TATTTCTATT CGGTTAAAAA CTTGGATGCT CTGAGTCTTA TTGTTGCCCT TCGGTTGTTG
TGGAATGCGA GTACTTACAG TGCT

Locus: Os03g0178000

Loading...

Locus: Os03g0178000

Loading...