Os03t0178000-02

Locus

Os03g0178000

Description

EF-1 alpha.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RFA2

CGSNL Gene Name

ELONGATION FACTOR 1A2

Oryzabase Gene Symbol Synonym(s)

rfa2*, REFA2, refa2, OsEF1alpna, EF1alpna

Oryzabase Gene Name Synonym(s)

rice elongation factor 1A (eEFIA)-2, rice elongation factor 1A-2, ELONGATION FACTOR 1A, Elongation factor 1-alpha, EF-1-alpha

Transcript Evidence

AK073196 (DDBJ, Best hit)

Protein Evidence

B8APM5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: translational elongation (GO:0006414)

Cellular Component: cytoplasm (GO:0005737)

Molecular Function: translation elongation factor activity (GO:0003746)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Protein synthesis factor, GTP-binding (IPR000795)

Translation elongation factor EFTu/EF1A, C-terminal (IPR004160)

Translation elongation factor EFTu/EF1A, domain 2 (IPR004161)

Translation elongation factor EF1A, eukaryotic/archaeal (IPR004539)

Translation elongation/initiation factor/Ribosomal, beta-barrel (IPR009000)

Translation elongation factor EF1A/initiation factor IF2gamma, C-terminal (IPR009001)

Full-length cDNA

J033024M04 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0178000-02)

Others

Oryzabase (2070)

KEGG (Os03t0178000-02 (EC:3.6.5.3))

Transcript

2156 bp

>Os03t0178000-02 EF-1 alpha.
agccgccgccgccgcagcctcctcctctcgtcttctccttcGAGGTCAGCTTCAGATCTT
CTCTCTTCTCCATATTTGCGCTTGTTCATGTTCGTTCGTAGCTGCAGATCTGGTTTAGTA
ACGTGAGGTTTCGGTGATTTCGAGCTGGGGCATGTTGTGTTCGCCCATTTTTTGTAACTT
TTTTCTGTGTATTCATCTCACTGCAATGATCTTCGTCTGCTGTTCGTTGACGCGACGATA
AACTTGATTTGTCAGTGAATCATCTGCATAGGTTGAAAATTATCGGCAGAATCGGACGAT
GAACTTGATTTGGTGCAGAATCATTTACATAAGTTGAAAATTATCGGTGGAATCACTAGA
AGGATTTTTATCTACAATCCGTTCGCATAGATCTCTTTCCGTGTTTCTGTAATTTTTTTT
ATTCTACTACTGCTGAGTAGATGTTATCGTCTGTACCCGGTTTGGTTGGGTCGATTACTG
CGCCTCTGTGCAAATCATCCGCCGATTAGCTGCGTTAGCACTTTTATAGCTGCCCAAGTT
TGATCTGTGAGCTTGCCTGCTATATTTATTTAGAGTTGTAAATTATACACTTATCTTTGT
TTCTAATATTTGTTTCGTTCTGTGCTGCAGTTGTTAGCTCCCTCCTTATTCAACCATGGG
TAAGGAGAAGACGCACATCAACATTGTGGTCATTGGCCACGTCGACTCCGGCAAGTCGAC
CACCACGGGCCATCTGATCTACAAGCTTGGAGGTATCGACAAGCGTGTGATCGAGAGGTT
CGAGAAGGAAGCCGCTGAGATGAACAAGAGGTCCTTCAAGTACGCGTGGGTGCTCGACAA
GCTCAAGGCCGAGCGTGAGAGAGGTATCACCATTGATATCGCCCTGTGGAAGTTCGAGAC
CACCAAGTACTACTGCACGGTCATCGATGCCCCTGGTCACCGTGACTTCATCAAGAACAT
GATCACGGGTACCTCCCAGGCTGACTGTGCCGTGCTCATCATTGACTCCACCACTGGTGG
TTTTGAGGCTGGTATCTCCAAGGATGGCCAGACCCGTGAGCACGCTCTTCTTGCTTTCAC
TCTTGGAGTGAAGCAGATGATCTGCTGCTGCAACAAGATGGATGCCACCACTCCCAAGTA
CTCCAAGGCCCGTTATGATGAAATCGTGAAGGAAGTCTCATCCTACCTGAAGAAGGTCGG
CTACAACCCTGACAAGATTCCCTTTGTTCCCATCTCTGGGTTTGAGGGTGACAACATGAT
TGAGAGGTCCACCAACCTTGACTGGTACAAGGGCCCCACCTTGCTTGAGGCTCTTGACCA
GATCAACGAGCCCAAGAGGCCATCAGACAAGCCCCTACGTCTTCCCCTTCAGGACGTGTA
CAAGATCGGCGGTATTGGTACCGTGCCTGTGGGTCGTGTTGAGACTGGTGTCCTCAAGCC
TGGTATGGTGGTGACCTTTGGTCCCAGCGGTCTGACCACTGAGGTCAAGTCGGTTGAGAT
GCACCACGAGGCTCTCCAGGAGGCTCTTCCTGGTGACAACGTTGGGTTCAACGTGAAGAA
CGTTGCCGTGAAGGATCTGAAGCGTGGGTACGTGGCCTCTAACTCCAAGGATGACCCTGC
CAAGGAGGCTGCCAGCTTCACCTCCCAGGTGATCATCATGAACCACCCTGGGCAGATCGG
CAATGGCTACGCCCCAGTGCTGGACTGCCACACCTCACACATTGCCGTCAAGTTTGCTGA
GCTGGTGACCAAGATCGACAGACGATCCGGCAAGGAGCTGGAGAAGGAGCCCAAGTTCCT
CAAGAACGGTGATGCTGGTATGGTTAAGATGATTCCCACCAAGCCCATGGTTGTGGAGAC
CTTCTCTGAGTACCCTCCTCTTGGTCGTTTTGCCGTGCGTGACATGAGGCAAACGGTGGC
TGTTGGCGTCATCAAGAACGTGGAGAAGAAGGACCCAACCGGTGCCAAGGTGACCAAGGC
TGCCGCCAAGAAGAAATGAGCATCGTTGAAGTGGTGGTTATGCTGGCTGCATTTGAGATA
TCTTAGCGTTCGTTAAGTTTTGCCCACGGCCATGGCACTCGTTGCATGGACCGTTAATAT
CTGCTCGCAATGTGCACTATGTTAGTCGTTTAAAACTCGTTTATTTCTATTCGGTT

CDS

1344 bp

>Os03t0178000-02 EF-1 alpha.
ATGGGTAAGGAGAAGACGCACATCAACATTGTGGTCATTGGCCACGTCGACTCCGGCAAG
TCGACCACCACGGGCCATCTGATCTACAAGCTTGGAGGTATCGACAAGCGTGTGATCGAG
AGGTTCGAGAAGGAAGCCGCTGAGATGAACAAGAGGTCCTTCAAGTACGCGTGGGTGCTC
GACAAGCTCAAGGCCGAGCGTGAGAGAGGTATCACCATTGATATCGCCCTGTGGAAGTTC
GAGACCACCAAGTACTACTGCACGGTCATCGATGCCCCTGGTCACCGTGACTTCATCAAG
AACATGATCACGGGTACCTCCCAGGCTGACTGTGCCGTGCTCATCATTGACTCCACCACT
GGTGGTTTTGAGGCTGGTATCTCCAAGGATGGCCAGACCCGTGAGCACGCTCTTCTTGCT
TTCACTCTTGGAGTGAAGCAGATGATCTGCTGCTGCAACAAGATGGATGCCACCACTCCC
AAGTACTCCAAGGCCCGTTATGATGAAATCGTGAAGGAAGTCTCATCCTACCTGAAGAAG
GTCGGCTACAACCCTGACAAGATTCCCTTTGTTCCCATCTCTGGGTTTGAGGGTGACAAC
ATGATTGAGAGGTCCACCAACCTTGACTGGTACAAGGGCCCCACCTTGCTTGAGGCTCTT
GACCAGATCAACGAGCCCAAGAGGCCATCAGACAAGCCCCTACGTCTTCCCCTTCAGGAC
GTGTACAAGATCGGCGGTATTGGTACCGTGCCTGTGGGTCGTGTTGAGACTGGTGTCCTC
AAGCCTGGTATGGTGGTGACCTTTGGTCCCAGCGGTCTGACCACTGAGGTCAAGTCGGTT
GAGATGCACCACGAGGCTCTCCAGGAGGCTCTTCCTGGTGACAACGTTGGGTTCAACGTG
AAGAACGTTGCCGTGAAGGATCTGAAGCGTGGGTACGTGGCCTCTAACTCCAAGGATGAC
CCTGCCAAGGAGGCTGCCAGCTTCACCTCCCAGGTGATCATCATGAACCACCCTGGGCAG
ATCGGCAATGGCTACGCCCCAGTGCTGGACTGCCACACCTCACACATTGCCGTCAAGTTT
GCTGAGCTGGTGACCAAGATCGACAGACGATCCGGCAAGGAGCTGGAGAAGGAGCCCAAG
TTCCTCAAGAACGGTGATGCTGGTATGGTTAAGATGATTCCCACCAAGCCCATGGTTGTG
GAGACCTTCTCTGAGTACCCTCCTCTTGGTCGTTTTGCCGTGCGTGACATGAGGCAAACG
GTGGCTGTTGGCGTCATCAAGAACGTGGAGAAGAAGGACCCAACCGGTGCCAAGGTGACC
AAGGCTGCCGCCAAGAAGAAATGA

Protein

448 aa

>Os03t0178000-02 EF-1 alpha.
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK
VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQD
VYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTEVKSVEMHHEALQEALPGDNVGFNV
KNVAVKDLKRGYVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
AELVTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQT
VAVGVIKNVEKKDPTGAKVTKAAAKKK*

5'UTR

chr03:4116944..4117598 (+ strand) : 655 bp

CDS

chr03:4117599..4118060 (+ strand) : 462 bp

chr03:4118648..4119529 (+ strand) : 882 bp

3'UTR

chr03:4119530..4119686 (+ strand) : 157 bp

FASTA

>Os03t0178000-02 class=Sequence position=chr03:4116944..4119686 (+ strand)
agccgccgcc gccgcagcct cctcctctcg tcttctcctt cGAGGTCAGC TTCAGATCTT CTCTCTTCTC CATATTTGCG
CTTGTTCATG TTCGTTCGTA GCTGCAGATC TGGTTTAGTA ACGTGAGGTT TCGGTGATTT CGAGCTGGGG CATGTTGTGT
TCGCCCATTT TTTGTAACTT TTTTCTGTGT ATTCATCTCA CTGCAATGAT CTTCGTCTGC TGTTCGTTGA CGCGACGATA
AACTTGATTT GTCAGTGAAT CATCTGCATA GGTTGAAAAT TATCGGCAGA ATCGGACGAT GAACTTGATT TGGTGCAGAA
TCATTTACAT AAGTTGAAAA TTATCGGTGG AATCACTAGA AGGATTTTTA TCTACAATCC GTTCGCATAG ATCTCTTTCC
GTGTTTCTGT AATTTTTTTT ATTCTACTAC TGCTGAGTAG ATGTTATCGT CTGTACCCGG TTTGGTTGGG TCGATTACTG
CGCCTCTGTG CAAATCATCC GCCGATTAGC TGCGTTAGCA CTTTTATAGC TGCCCAAGTT TGATCTGTGA GCTTGCCTGC
TATATTTATT TAGAGTTGTA AATTATACAC TTATCTTTGT TTCTAATATT TGTTTCGTTC TGTGCTGCAG TTGTTAGCTC
CCTCCTTATT CAACCATGGG TAAGGAGAAG ACGCACATCA ACATTGTGGT CATTGGCCAC GTCGACTCCG GCAAGTCGAC
CACCACGGGC CATCTGATCT ACAAGCTTGG AGGTATCGAC AAGCGTGTGA TCGAGAGGTT CGAGAAGGAA GCCGCTGAGA
TGAACAAGAG GTCCTTCAAG TACGCGTGGG TGCTCGACAA GCTCAAGGCC GAGCGTGAGA GAGGTATCAC CATTGATATC
GCCCTGTGGA AGTTCGAGAC CACCAAGTAC TACTGCACGG TCATCGATGC CCCTGGTCAC CGTGACTTCA TCAAGAACAT
GATCACGGGT ACCTCCCAGG CTGACTGTGC CGTGCTCATC ATTGACTCCA CCACTGGTGG TTTTGAGGCT GGTATCTCCA
AGGATGGCCA GACCCGTGAG CACGCTCTTC TTGCTTTCAC TCTTGGAGTG AAGCAGATGA TCTGCTGCTG CAACAAGGTA
TATCTCTAGT GTTCGGTCTT TTGTTATGAT TGTTGAGCCT AGCACTTGTT TGTACATATT CGTGATGCTA TTCTAGATAC
AATGAAGTCG CATAATCTGT TTTATTCACT ATGCATCTAA TACTTCAATG TTTGATTCTT GCATATCTGT CTTCTTTTAT
GATTGATCTG CACAGCACTT CTGTACATAT TCGTGATGCT TGTCCTGAAT ACTCTTGATT ACATCAATGA AGTAGCTTTC
ATTTGAACGT CTAGTTGTTT GTTACTTTAT ACTAAGCATC TATTTGATTG GTTTAGGTTA TATTTTAAAT TATCTGGTTG
TGGTGTTGTA CTTCATTTTG TCATTTTTAT CCTGCTGGAA GTTGCAGCCC CTGTCCTGTT TCATTACATC TTATCTGGTC
ACTGTGTATC TTATATGCTG TTAAGTACCT TTTGATACTC CTACATCTGG TCCCTGCTCT TGTATATCTT ATATGCTGTT
TTAAGTATTG TTTCATATGA TCATATCTTG TATGGTTATC TTTGTTTGGT TGCCAACTGA CCCCCTGCTG AGGAAAGTTA
TTGTTTTCCT TTGTTCTGTT ACAGATGGAT GCCACCACTC CCAAGTACTC CAAGGCCCGT TATGATGAAA TCGTGAAGGA
AGTCTCATCC TACCTGAAGA AGGTCGGCTA CAACCCTGAC AAGATTCCCT TTGTTCCCAT CTCTGGGTTT GAGGGTGACA
ACATGATTGA GAGGTCCACC AACCTTGACT GGTACAAGGG CCCCACCTTG CTTGAGGCTC TTGACCAGAT CAACGAGCCC
AAGAGGCCAT CAGACAAGCC CCTACGTCTT CCCCTTCAGG ACGTGTACAA GATCGGCGGT ATTGGTACCG TGCCTGTGGG
TCGTGTTGAG ACTGGTGTCC TCAAGCCTGG TATGGTGGTG ACCTTTGGTC CCAGCGGTCT GACCACTGAG GTCAAGTCGG
TTGAGATGCA CCACGAGGCT CTCCAGGAGG CTCTTCCTGG TGACAACGTT GGGTTCAACG TGAAGAACGT TGCCGTGAAG
GATCTGAAGC GTGGGTACGT GGCCTCTAAC TCCAAGGATG ACCCTGCCAA GGAGGCTGCC AGCTTCACCT CCCAGGTGAT
CATCATGAAC CACCCTGGGC AGATCGGCAA TGGCTACGCC CCAGTGCTGG ACTGCCACAC CTCACACATT GCCGTCAAGT
TTGCTGAGCT GGTGACCAAG ATCGACAGAC GATCCGGCAA GGAGCTGGAG AAGGAGCCCA AGTTCCTCAA GAACGGTGAT
GCTGGTATGG TTAAGATGAT TCCCACCAAG CCCATGGTTG TGGAGACCTT CTCTGAGTAC CCTCCTCTTG GTCGTTTTGC
CGTGCGTGAC ATGAGGCAAA CGGTGGCTGT TGGCGTCATC AAGAACGTGG AGAAGAAGGA CCCAACCGGT GCCAAGGTGA
CCAAGGCTGC CGCCAAGAAG AAATGAGCAT CGTTGAAGTG GTGGTTATGC TGGCTGCATT TGAGATATCT TAGCGTTCGT
TAAGTTTTGC CCACGGCCAT GGCACTCGTT GCATGGACCG TTAATATCTG CTCGCAATGT GCACTATGTT AGTCGTTTAA
AACTCGTTTA TTTCTATTCG GTT

Locus: Os03g0178000

Loading...

Locus: Os03g0178000

Loading...