Os03t0181100-01

Locus

Os03g0181100

Description

Tify domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

TIFY11B

CGSNL Gene Name

TIFY GENE 11B

Oryzabase Gene Symbol Synonym(s)

OsJAZ4, JAZ4, OsJAZ 10, OsJAZ10, JAZ10, OsTIFY11b

Oryzabase Gene Name Synonym(s)

Jasmonate ZIM-domain protein 4, Jasmonate ZIM-domain protein 10

Transcript Evidence

AK120087 (DDBJ, Best hit)

Protein Evidence

NP_001149525.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Tify (IPR010399)

CO/COL/TOC1, conserved site (IPR018467)

Full-length cDNA

J013020K01 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0181100-01)

RiceXPro (AK120087)

Others

Oryzabase (9490)

KEGG (Os03t0181100-01)

Transcript

937 bp

>Os03t0181100-01 Tify domain containing protein.
GCTTCCTCCTCCTTCCCCAACTTGCCTCCAATTCCAAGTTCCAACCCTCCACCTCCCTAT
ATAACACAGCTCTTCCCACCCCGTCAAATCCCACGACTCAAAACCACCAAAACTCACCAA
GCAAAGCACCAGCGAGGAAGAACAAGAAGGAAGGTGAAGAGAAGCCGCGTTTTGTTTCTC
GCGAAAGTGTTTGTTGATATGGCGATGGAGGGGAAGAGCAGGAGGTTCGCGGTGGCGTGC
GGGGTGCTCAGCCAGTACGTGAGGGCGGAGCAGAAGATGGCGGCGGCGGCGGGGGCGGCA
CCGGCGAGGGCGGTGACGACGCTGAGCCTGATGCCTGGGGCGGAGGTGGTCGTCGAGGAG
GAGGAGCGGAGGGAGGTTGGGGAGGAGGAGGCGGGGCCAGCGACGGCGCCGGCCGCGCCG
CTGACCATCTTCTACGGTGGGAGGATGGTCGTCTTCGAGGACTTCCCCGCGGACAAGGCG
GCGGAGGTGATGCGCATGGCCTCCTCCGGGATGGCGGCGGCGCCGGCTCAGCGGGAGGGC
GCCGCGCTCGCGGACATGCCCATCATGAGGAAGGCGTCGCTGCAGCGGTTCTTCGCCAAG
CGCAAGGACCGCCTCGCGGCGACCACCCCCTACGCCCGCCCGTCGCCGGCGGAGACCAAG
GCCTCCGAGCCGGAGGAGAAGAAGACGCCCACCTCATGGCTGGACCTCGCCGCCTCCGCC
TCCGCCGCCGCGCGCCGTGACAGCCTCACCATCGCGCTGTGATCTGCGCGGCTTTGACCA
AAAACGACTTAAGACGCGCGCGCGCTCTCAGCGCGCAAGAGGATTGATTCACTTTGCTCA
TACCCATGGCGACGTAGAGTTTTTACCGCTTTTGCTATACTTCTTTGTAAAATTCGATAG
GGAGATTGAATTGATGGGAAACCCCTTGTGCCTGTTC

CDS

564 bp

>Os03t0181100-01 Tify domain containing protein.
ATGGCGATGGAGGGGAAGAGCAGGAGGTTCGCGGTGGCGTGCGGGGTGCTCAGCCAGTAC
GTGAGGGCGGAGCAGAAGATGGCGGCGGCGGCGGGGGCGGCACCGGCGAGGGCGGTGACG
ACGCTGAGCCTGATGCCTGGGGCGGAGGTGGTCGTCGAGGAGGAGGAGCGGAGGGAGGTT
GGGGAGGAGGAGGCGGGGCCAGCGACGGCGCCGGCCGCGCCGCTGACCATCTTCTACGGT
GGGAGGATGGTCGTCTTCGAGGACTTCCCCGCGGACAAGGCGGCGGAGGTGATGCGCATG
GCCTCCTCCGGGATGGCGGCGGCGCCGGCTCAGCGGGAGGGCGCCGCGCTCGCGGACATG
CCCATCATGAGGAAGGCGTCGCTGCAGCGGTTCTTCGCCAAGCGCAAGGACCGCCTCGCG
GCGACCACCCCCTACGCCCGCCCGTCGCCGGCGGAGACCAAGGCCTCCGAGCCGGAGGAG
AAGAAGACGCCCACCTCATGGCTGGACCTCGCCGCCTCCGCCTCCGCCGCCGCGCGCCGT
GACAGCCTCACCATCGCGCTGTGA

Protein

188 aa

>Os03t0181100-01 Tify domain containing protein.
MAMEGKSRRFAVACGVLSQYVRAEQKMAAAAGAAPARAVTTLSLMPGAEVVVEEEERREV
GEEEAGPATAPAAPLTIFYGGRMVVFEDFPADKAAEVMRMASSGMAAAPAQREGAALADM
PIMRKASLQRFFAKRKDRLAATTPYARPSPAETKASEPEEKKTPTSWLDLAASASAAARR
DSLTIAL*

5'UTR

chr03:4248884..4249081 (+ strand) : 198 bp

CDS

chr03:4249082..4249645 (+ strand) : 564 bp

3'UTR

chr03:4249646..4249820 (+ strand) : 175 bp

FASTA

>Os03t0181100-01 class=Sequence position=chr03:4248884..4249820 (+ strand)
GCTTCCTCCT CCTTCCCCAA CTTGCCTCCA ATTCCAAGTT CCAACCCTCC ACCTCCCTAT ATAACACAGC TCTTCCCACC
CCGTCAAATC CCACGACTCA AAACCACCAA AACTCACCAA GCAAAGCACC AGCGAGGAAG AACAAGAAGG AAGGTGAAGA
GAAGCCGCGT TTTGTTTCTC GCGAAAGTGT TTGTTGATAT GGCGATGGAG GGGAAGAGCA GGAGGTTCGC GGTGGCGTGC
GGGGTGCTCA GCCAGTACGT GAGGGCGGAG CAGAAGATGG CGGCGGCGGC GGGGGCGGCA CCGGCGAGGG CGGTGACGAC
GCTGAGCCTG ATGCCTGGGG CGGAGGTGGT CGTCGAGGAG GAGGAGCGGA GGGAGGTTGG GGAGGAGGAG GCGGGGCCAG
CGACGGCGCC GGCCGCGCCG CTGACCATCT TCTACGGTGG GAGGATGGTC GTCTTCGAGG ACTTCCCCGC GGACAAGGCG
GCGGAGGTGA TGCGCATGGC CTCCTCCGGG ATGGCGGCGG CGCCGGCTCA GCGGGAGGGC GCCGCGCTCG CGGACATGCC
CATCATGAGG AAGGCGTCGC TGCAGCGGTT CTTCGCCAAG CGCAAGGACC GCCTCGCGGC GACCACCCCC TACGCCCGCC
CGTCGCCGGC GGAGACCAAG GCCTCCGAGC CGGAGGAGAA GAAGACGCCC ACCTCATGGC TGGACCTCGC CGCCTCCGCC
TCCGCCGCCG CGCGCCGTGA CAGCCTCACC ATCGCGCTGT GATCTGCGCG GCTTTGACCA AAAACGACTT AAGACGCGCG
CGCGCTCTCA GCGCGCAAGA GGATTGATTC ACTTTGCTCA TACCCATGGC GACGTAGAGT TTTTACCGCT TTTGCTATAC
TTCTTTGTAA AATTCGATAG GGAGATTGAA TTGATGGGAA ACCCCTTGTG CCTGTTC