Os03t0181100-02

Locus

Os03g0181100

Description

Tify domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

TIFY11B

CGSNL Gene Name

TIFY GENE 11B

Oryzabase Gene Symbol Synonym(s)

OsJAZ4, JAZ4, OsJAZ 10, OsJAZ10, JAZ10, OsTIFY11b

Oryzabase Gene Name Synonym(s)

Jasmonate ZIM-domain protein 4, Jasmonate ZIM-domain protein 10

Transcript Evidence

AK067971 (DDBJ, Best hit)

Protein Evidence

NP_001149525.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Tify (IPR010399)

CO/COL/TOC1, conserved site (IPR018467)

Full-length cDNA

J013123K19 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0181100-02)

RiceXPro (AK067971)

Others

Oryzabase (9490)

KEGG (Os03t0181100-02)

Transcript

841 bp

>Os03t0181100-02 Tify domain containing protein.
ACGACTCAAAACCACCAAAACTCACCAAGCAAAGCACCAGCGAGGAAGAACAAGAAGGAA
GGTGAAGAGAAGCCGCGTTTTGTTTCTCGCGAAAGTGTTTGTTGATATGGCGATGGAGGG
GAAGAGCAGGAGGTTCGCGGTGGCGTGCGGGGTGCTCAGCCAGTACGTGAGGGCGGAGCA
GAAGATGGCGGCGGCGGCGGGGGCGGCACCGGCGAGGGCGGTGACGACGCTGAGCCTGAT
GCCTGGGGCGGAGGTGGTCGTCGAGGAGGAGGAGCGGAGGGAGGTTGGGGAGGAGGAGGC
GGGGCCAGCGACGGCGCCGGCCGCGCCGCTGACCATCTTCTACGGTGGGAGGATGGTCGT
CTTCGAGGACTTCCCCGCGGACAAGGCGGCGGAGGTGATGCGCATGGCCTCCTCCGGGAT
GGCGGCGGCGCCGGCTCAGCGGGAGGGCGCCGCGCTCGCGGACATGCCCATCATGAGGAA
GGCGTCGCTGCAGCGGTTCTTCGCCAAGCGCAAGGACCGCCTCGCGGCGACCACCCCCTA
CGCCCGCCCGTCGCCGGCGGAGACCAAGGCCTCCGAGCCGGAGGAGAAGAAGACGCCCAC
CTCATGGCTGGACCTCGCCGCCTCCGCCTCCGCCGCCGCGCGCCGTGACAGCCTCACCAT
CGCGCTGTGATCTGCGCGGCTTTGACCAAAAACGACTTAAGACGCGCGCGCGCTCTCAGC
GCGCAAGAGGATTGATTCACTTTGCTCATACCCATGGCGACGTAGAGTTTTTACCGCTTT
TGCTATACTTCTTTGTAAAATTCGATAGGGAGATTGAATTGATGGGAAACCCCTTGTGCC
T

CDS

564 bp

>Os03t0181100-02 Tify domain containing protein.
ATGGCGATGGAGGGGAAGAGCAGGAGGTTCGCGGTGGCGTGCGGGGTGCTCAGCCAGTAC
GTGAGGGCGGAGCAGAAGATGGCGGCGGCGGCGGGGGCGGCACCGGCGAGGGCGGTGACG
ACGCTGAGCCTGATGCCTGGGGCGGAGGTGGTCGTCGAGGAGGAGGAGCGGAGGGAGGTT
GGGGAGGAGGAGGCGGGGCCAGCGACGGCGCCGGCCGCGCCGCTGACCATCTTCTACGGT
GGGAGGATGGTCGTCTTCGAGGACTTCCCCGCGGACAAGGCGGCGGAGGTGATGCGCATG
GCCTCCTCCGGGATGGCGGCGGCGCCGGCTCAGCGGGAGGGCGCCGCGCTCGCGGACATG
CCCATCATGAGGAAGGCGTCGCTGCAGCGGTTCTTCGCCAAGCGCAAGGACCGCCTCGCG
GCGACCACCCCCTACGCCCGCCCGTCGCCGGCGGAGACCAAGGCCTCCGAGCCGGAGGAG
AAGAAGACGCCCACCTCATGGCTGGACCTCGCCGCCTCCGCCTCCGCCGCCGCGCGCCGT
GACAGCCTCACCATCGCGCTGTGA

Protein

188 aa

>Os03t0181100-02 Tify domain containing protein.
MAMEGKSRRFAVACGVLSQYVRAEQKMAAAAGAAPARAVTTLSLMPGAEVVVEEEERREV
GEEEAGPATAPAAPLTIFYGGRMVVFEDFPADKAAEVMRMASSGMAAAPAQREGAALADM
PIMRKASLQRFFAKRKDRLAATTPYARPSPAETKASEPEEKKTPTSWLDLAASASAAARR
DSLTIAL*

5'UTR

chr03:4248976..4249081 (+ strand) : 106 bp

CDS

chr03:4249082..4249645 (+ strand) : 564 bp

3'UTR

chr03:4249646..4249816 (+ strand) : 171 bp

FASTA

>Os03t0181100-02 class=Sequence position=chr03:4248976..4249816 (+ strand)
ACGACTCAAA ACCACCAAAA CTCACCAAGC AAAGCACCAG CGAGGAAGAA CAAGAAGGAA GGTGAAGAGA AGCCGCGTTT
TGTTTCTCGC GAAAGTGTTT GTTGATATGG CGATGGAGGG GAAGAGCAGG AGGTTCGCGG TGGCGTGCGG GGTGCTCAGC
CAGTACGTGA GGGCGGAGCA GAAGATGGCG GCGGCGGCGG GGGCGGCACC GGCGAGGGCG GTGACGACGC TGAGCCTGAT
GCCTGGGGCG GAGGTGGTCG TCGAGGAGGA GGAGCGGAGG GAGGTTGGGG AGGAGGAGGC GGGGCCAGCG ACGGCGCCGG
CCGCGCCGCT GACCATCTTC TACGGTGGGA GGATGGTCGT CTTCGAGGAC TTCCCCGCGG ACAAGGCGGC GGAGGTGATG
CGCATGGCCT CCTCCGGGAT GGCGGCGGCG CCGGCTCAGC GGGAGGGCGC CGCGCTCGCG GACATGCCCA TCATGAGGAA
GGCGTCGCTG CAGCGGTTCT TCGCCAAGCG CAAGGACCGC CTCGCGGCGA CCACCCCCTA CGCCCGCCCG TCGCCGGCGG
AGACCAAGGC CTCCGAGCCG GAGGAGAAGA AGACGCCCAC CTCATGGCTG GACCTCGCCG CCTCCGCCTC CGCCGCCGCG
CGCCGTGACA GCCTCACCAT CGCGCTGTGA TCTGCGCGGC TTTGACCAAA AACGACTTAA GACGCGCGCG CGCTCTCAGC
GCGCAAGAGG ATTGATTCAC TTTGCTCATA CCCATGGCGA CGTAGAGTTT TTACCGCTTT TGCTATACTT CTTTGTAAAA
TTCGATAGGG AGATTGAATT GATGGGAAAC CCCTTGTGCC T