Os03t0181500-01

Locus

Os03g0181500

Description

Fatty acid elongase (beta-ketoacyl-CoA synthase), Shoot development

RAP-DB Gene Symbol Synonym(s)

ONI1

RAP-DB Gene Name Synonym(s)

ONION1

CGSNL Gene Symbol

ONI1

CGSNL Gene Name

ONION 1

Oryzabase Gene Symbol Synonym(s)

OsONI1

Oryzabase Gene Name Synonym(s)

ONION1

Transcript Evidence

AK099232

AK060840

AK061335

AK119228

Protein Evidence

Q10QW1

Literature

PMID: 21309865

Note

Manual Curation

December 5, 2014

Gene Ontology (GO)

Biological Process: fatty acid biosynthetic process (GO:0006633)

Biological Process: metabolic process (GO:0008152)

Biological Process: lipid biosynthetic process (GO:0008610)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Very-long-chain 3-ketoacyl-CoA synthase (IPR012392)

Thiolase-like (IPR016039)

Thiolase-like, subgroup (IPR016038)

FAE1/Type III polyketide synthase-like protein (IPR013601)

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (IPR013747)

Full-length cDNA

006-303-B10 (Online Clone Ordering)

001-034-D04 (Online Clone Ordering)

J013094M20 (Online Clone Ordering)

001-101-A08 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0181500-01)

Others

Oryzabase (12365)

KEGG (Os03t0181500-01)

Transcript

1909 bp

>Os03t0181500-01 Fatty acid elongase (beta-ketoacyl-CoA synthase), Shoot development
ACTTCACTGCCTTCTCATTTACTGCAGAAGGTGAAGGTGAAGGAGGAGGCGGCCATGGCG
AGGGAGCAGGCGCTGCTGTTGACGGAGATCGTGAACCGCGGCGTGGAGCCGTCGGGGCCG
GACGCCGGGTCGCCGACGTTCTCGGTGCGGGTGCGGCGGCGGCTGCCGGACTTCCTCCAG
TCGGTGAACCTCAAGTACGTGCGGCTCGGGTACCACTACCTCATCAGCCACGGCGTGTAC
CTGGCCACCATCCCGGTCATCGTGCTCGTCTGCGGCGCCGAGGTCGGCAGCCTCAGCCGA
GACGAGCTGTGGCGCAAGGTCTGGGGCGAGGCCACCTACGACCTCGCCACCGTCCTCGCC
TTCCTCGCCGTCCTCGCCTTCACCATCTCCGTCTACATCATGTCCAGGCCTAGGCCCGTC
TACCTCATCGACTTCGCCTGCTACAAACCAGCCGACGAACTCAAGGTGTCGAAGGCGGAG
TTCATCGATCTGGCGAGGAAGTCGGGCAAGTTCGACGAGGATAGCCTGGCGTTCCAGTCG
CGGCTGCTGGCcaagtctggcatcggcgacgagtcctacatgccgcgctgcgtgttcgag
ccgggcaccaactgcgccaccatgaaggaaggccgcgccgaggcgtccgccgccatgttc
gccgcgctggacgagctgttcgacaagtgccgcgtccgccccaaggacgtcggcgtgctc
gtcgtcaactgcagcctcttcaacccgacgccgtcgctgtccgccatgatcgtcaaccac
tacaagatgcgcgggaacatcctcagctacaacctcggcggcatggggtgcagcgccggc
gtcatcgcggtggacctcgcccgcgacatgctccaggccagcggcgcggggctcgccgtc
gtcgtcagcacggaggccgtctccttcacctggtacgccgggaagcgccgctccatgctc
atccccaacgccttcttccgcgccggctgcgccgccgtgctgctctccaaccgccgcagg
gacttccaccgcgccaagtaccagctcgagcacatcgtgcgcacccacaagggcgccgac
gaccgcagcttccggtcggtgtaccaggaggaggacgagcagcggatcaagggcctgtcc
atcagccgcgacctcgtggaggtcggcggccacgcgctcaagaccaacatcaccaccctg
ggcccgctcgtgcttccgttctcggagcagatcctcttcttcgccggcgtgctcttccgc
cacctgttcccgtccaagacctccgccccgccgccgccgtccgccgacggcgacgcctcc
gccgccgctccctacatcccggacttcaagcgcgcgttcgagcacttctgcatgcacgcg
gcgagccgcgacgtgctggagcacctgcagggcaacctgggcctccgcgacggcgacctg
gaggcgtcgcgcgccgcgctccaccgcttcggcaacacgtcgagcagcagcatctggtac
gagctggcgtacctggaggccaagggccgcgtccgccgcggcgaccgcgtgtggcagctc
gccttcggctccgggttcaagtgcaacagcgccgtgtggcgcgccgtccgccgcgtgcgc
cgcccggcgcgcagcccgtggctggactgcgtcgagcagtacccgGCTCGCATGAACGCT
TAAGCTGCAGTGGTAAGTATGCAGAGGCTAATGAACGGAAAATTACTGCAACGTCAAAAG
ACGGGATCGGCATGCGATGCCGGTTAAGGTTCAAGCTTGATTAATTTGTGTTGGTGTATT
AGCAAGTCGGTTTATGAGCCATAGACTACCATAAAAGTTGTGCGAGACATGTGTACTGAA
CCAGTGTACGCGAGTTCGGTGATATGTGAACTTATCTACGTTTGATTCT

CDS

1629 bp

>Os03t0181500-01 Fatty acid elongase (beta-ketoacyl-CoA synthase), Shoot development
ATGGCGAGGGAGCAGGCGCTGCTGTTGACGGAGATCGTGAACCGCGGCGTGGAGCCGTCG
GGGCCGGACGCCGGGTCGCCGACGTTCTCGGTGCGGGTGCGGCGGCGGCTGCCGGACTTC
CTCCAGTCGGTGAACCTCAAGTACGTGCGGCTCGGGTACCACTACCTCATCAGCCACGGC
GTGTACCTGGCCACCATCCCGGTCATCGTGCTCGTCTGCGGCGCCGAGGTCGGCAGCCTC
AGCCGAGACGAGCTGTGGCGCAAGGTCTGGGGCGAGGCCACCTACGACCTCGCCACCGTC
CTCGCCTTCCTCGCCGTCCTCGCCTTCACCATCTCCGTCTACATCATGTCCAGGCCTAGG
CCCGTCTACCTCATCGACTTCGCCTGCTACAAACCAGCCGACGAACTCAAGGTGTCGAAG
GCGGAGTTCATCGATCTGGCGAGGAAGTCGGGCAAGTTCGACGAGGATAGCCTGGCGTTC
CAGTCGCGGCTGCTGGCcaagtctggcatcggcgacgagtcctacatgccgcgctgcgtg
ttcgagccgggcaccaactgcgccaccatgaaggaaggccgcgccgaggcgtccgccgcc
atgttcgccgcgctggacgagctgttcgacaagtgccgcgtccgccccaaggacgtcggc
gtgctcgtcgtcaactgcagcctcttcaacccgacgccgtcgctgtccgccatgatcgtc
aaccactacaagatgcgcgggaacatcctcagctacaacctcggcggcatggggtgcagc
gccggcgtcatcgcggtggacctcgcccgcgacatgctccaggccagcggcgcggggctc
gccgtcgtcgtcagcacggaggccgtctccttcacctggtacgccgggaagcgccgctcc
atgctcatccccaacgccttcttccgcgccggctgcgccgccgtgctgctctccaaccgc
cgcagggacttccaccgcgccaagtaccagctcgagcacatcgtgcgcacccacaagggc
gccgacgaccgcagcttccggtcggtgtaccaggaggaggacgagcagcggatcaagggc
ctgtccatcagccgcgacctcgtggaggtcggcggccacgcgctcaagaccaacatcacc
accctgggcccgctcgtgcttccgttctcggagcagatcctcttcttcgccggcgtgctc
ttccgccacctgttcccgtccaagacctccgccccgccgccgccgtccgccgacggcgac
gcctccgccgccgctccctacatcccggacttcaagcgcgcgttcgagcacttctgcatg
cacgcggcgagccgcgacgtgctggagcacctgcagggcaacctgggcctccgcgacggc
gacctggaggcgtcgcgcgccgcgctccaccgcttcggcaacacgtcgagcagcagcatc
tggtacgagctggcgtacctggaggccaagggccgcgtccgccgcggcgaccgcgtgtgg
cagctcgccttcggctccgggttcaagtgcaacagcgccgtgtggcgcgccgtccgccgc
gtgcgccgcccggcgcgcagcccgtggctggactgcgtcgagcagtacccgGCTCGCATG
AACGCTTAA

Protein

543 aa

>Os03t0181500-01 Fatty acid elongase (beta-ketoacyl-CoA synthase), Shoot development
MAREQALLLTEIVNRGVEPSGPDAGSPTFSVRVRRRLPDFLQSVNLKYVRLGYHYLISHG
VYLATIPVIVLVCGAEVGSLSRDELWRKVWGEATYDLATVLAFLAVLAFTISVYIMSRPR
PVYLIDFACYKPADELKVSKAEFIDLARKSGKFDEDSLAFQSRLLAKSGIGDESYMPRCV
FEPGTNCATMKEGRAEASAAMFAALDELFDKCRVRPKDVGVLVVNCSLFNPTPSLSAMIV
NHYKMRGNILSYNLGGMGCSAGVIAVDLARDMLQASGAGLAVVVSTEAVSFTWYAGKRRS
MLIPNAFFRAGCAAVLLSNRRRDFHRAKYQLEHIVRTHKGADDRSFRSVYQEEDEQRIKG
LSISRDLVEVGGHALKTNITTLGPLVLPFSEQILFFAGVLFRHLFPSKTSAPPPPSADGD
ASAAAPYIPDFKRAFEHFCMHAASRDVLEHLQGNLGLRDGDLEASRAALHRFGNTSSSSI
WYELAYLEAKGRVRRGDRVWQLAFGSGFKCNSAVWRAVRRVRRPARSPWLDCVEQYPARM
NA*

5'UTR

chr03:4266978..4267031 (+ strand) : 54 bp

CDS

chr03:4267032..4267442 (+ strand) : 411 bp

chr03:4270335..4271552 (+ strand) : 1218 bp

3'UTR

chr03:4271553..4271778 (+ strand) : 226 bp

FASTA

>Os03t0181500-01 class=Sequence position=chr03:4266978..4271778 (+ strand)
ACTTCACTGC CTTCTCATTT ACTGCAGAAG GTGAAGGTGA AGGAGGAGGC GGCCATGGCG AGGGAGCAGG CGCTGCTGTT
GACGGAGATC GTGAACCGCG GCGTGGAGCC GTCGGGGCCG GACGCCGGGT CGCCGACGTT CTCGGTGCGG GTGCGGCGGC
GGCTGCCGGA CTTCCTCCAG TCGGTGAACC TCAAGTACGT GCGGCTCGGG TACCACTACC TCATCAGCCA CGGCGTGTAC
CTGGCCACCA TCCCGGTCAT CGTGCTCGTC TGCGGCGCCG AGGTCGGCAG CCTCAGCCGA GACGAGCTGT GGCGCAAGGT
CTGGGGCGAG GCCACCTACG ACCTCGCCAC CGTCCTCGCC TTCCTCGCCG TCCTCGCCTT CACCATCTCC GTCTACATCA
TGTCCAGGCC TAGGCCCGTC TACCTCATCG ACTTCGCCTG CTACAAACCA GCCGACGAAC TCAAGGTAAT ACTACTTAAT
TCCATGCTTA ATCACGTATA CACATATTCG GTAGTTCATC GGAGTAGATT AGTATTATAT TACTAGTATT ATGTTTAAAT
GAAAGCATAT TATGCCAATG TGTGAAGCTC CTAGGATCTA TGATTTGTTA CTGCGCAAGA AACTTGTTCG TTCTAACATT
TCAGATCTCA CGTAAATTGA ATCGGCCAAG GTTTTATTCT GAAACAATAA AAGCATATTT CTGGTGCAAA AGGATAGATC
GGATAAAACA TATATATTGA CGTTATACAA AGTGCTCAAG GACTAAATGA AGGTCTCATA TGGAGCTAGC ATAGGATCGA
ATTTCATGAT TCATGGAATC CACATGGTCC TTCAGTGATC TAGCCAACTG TTTTTCAAAC AGCGCCATTC TTTTTTTTTT
TTTGAGACGA ATCAAACAAC GCAAATTAAA ACTGCAAATA TACTTTTGGA TTTACCGGAC GTAGTAGCTG AAATCTCAAA
ACTGTGAAAG CTATTCAAGG TGAGGTGTGA AGAGAAAACT CTTGGAACGT GTAAGCCTTG GGCCTCCTTT AATGGTTGAG
CTAGCTCATG CTTGTCCACC TCATATAAGA GATAGTAAAA AGTCTACCTC TCCCATAGAT TGTCTCATAG CACATTGTAT
AAAATGCTTT AGGTTTCACA ATTTCTTTAG TAGCTTAGCT CTTAAAGAAG AGATAGTGCA TTCTCTTTCC TTATCTTCTC
TCTCTTCCAC ATCATACAAA AGCTGATGTG GAGATTTATG AGCTAGCTGA CTTACCTTTG TTGGAGGAGG GTTTAGTATT
AACTGCTGGA TGAACTTGCA TTGACAACAA CAAAAAAAAA AAAACTCATC ATCAGTTGGG CTTTTAGTTG TGAATAACTA
TTGGTATAGT GGTGTCTATA GCTAGTACTA CTCCGCATGG TCCTTTAATA CGGTCATAAT CCTTGCCAGC TACTACCAGC
TCAAATGCTT TTAATGTAGC ACACATTCAC TATTTGAGCA CTGACAAATC TGCCCGGCAC TGACTGAAAT ACCCGAGCCA
CGCTCATACG ATTACCACCT CCATTTTACT TGACAGCCCT AGATAGAACC GGTGTGATTC GTCTTTTTTT TTTCCTTGAG
ATTTCACCAC ATTGGCATAT TTGAAATCAT CTTGAATTAA ATTTTTAGAA ATTATATCAT TAGATCCATC ATAAAAAAAA
TACTTCCATA CTTAGTATAC GCTTGTTATt actccctcca tttcaggtta taaaatattt tgactttggt caaagtcaaa
ctttcaagtt tgaccaagtt tatataaaaa aatagtaata ttttcgaccg aagataaatt tattataaaa atatatttaa
ttattaattt aataaaacta atttgctaat ttaaatatta ccatattttt catatttgtc tataaactta gttaaatttg
aagcagtttg actttgacca aagtcaaaac atcttataac atgaaacgga gggattaTAT CCTAACACAA CGTTGTAAAA
TGTGCAATGG TCAAAGCAAT ATCTTAGAAA TTGCACAAAA AAAAAAGAAC GGAGGTAGTG CTATTTTGTA TGAATCAAAT
TCATTTATCA TATATTGATT CTACACCTAA TAAGTTTACA CTAGATAGAT GCTTTTCCTT GTGCCCGAGT GCCTCTGTTA
TCTTGTACTG TATGTTACTT TTAGTATAAA TACTGCCATC ATTCTCAAGT AAAGTCTTTG ACCACTGCTT TTTTCCCTGA
TTACTCTATG TTGACTAAAG GAATGGTAAT AAAATATTAA CTGAATATTA TAAAGTATTT ACATGATATA TTAGATCCAA
AATTGATAAG AAGCTCCTCC TTAGTAGATA CTCCAAAAGA AACTCTAGTT ATATCTTTGC AGACTTAggc ctggtttagt
tctccaattt tttttcccta aaacataaca tcgaatcttt gaacacatgc atggagcatt aaatataaat tacaaaaact
aattgcacag ttagggggga aatcacgaga cgaatctttt gagcctaatt agtccataat tagccatatg tgctacagta
atccacatgt gctaatgaca gattaattag gctcaaaaga tttgtctcgc ggtttccaaa cgagttatga aattattttt
tcattcgtat ccgaaaaccc cttcgacatc cggtgaaata tctgatatga catataaaaa atttcttttc acgaaACCGC
GTtatgaaat tagttttttc attcgtatct gaaaacctct ttcgacatcc ggtaaaatat ctgatgtgac atataaaaat
tttcttttca cgaactaaac aggcccttat atgCTACACA TCACTAAGTT TTGGAAAACA GTTTGTTGGC TACCATTATT
TTGTTGGAGT CTTGAATGCA AGTTAGGAGG CACCTTTGGT TGGGCCCCAG TCCTTGGAAG TGAATGGGCA GGGCAGGGTC
GAAGTTATGA CGAGCTGGTA GGATGCTTTC GGTTATGGCC AGGCCAGCCG GTGACTCGAT CAGTCGATCG CTCTCACTTG
CTCGTGTCAT CAAATACGGT TGGGCGATTG GGCACACACA TTCAATGAGC CGAACCGTAT TATTAAACCG TAAATGTTTT
GCGTGAGCAC ACATTTTCTT TTCGAAAAAT GTTTTGCGTG AGCACACAAA CCACAACCTG CACTATCCTT GCACGCACGA
TGGATTTGAG TCAAACAACC AAGTTTACCC GGTTCGCATG CATGAAATTT CTTCGATTTC ACTTGTTACT TACAGTTTGT
AATCAGTTTG ATGCATTATG GTACTAGCTG GTGATTTGTA AGCAAGGATG TGATTTTGCA TGGACAATTG CTTGCAGGTG
TCGAAGGCGG AGTTCATCGA TCTGGCGAGG AAGTCGGGCA AGTTCGACGA GGATAGCCTG GCGTTCCAGT CGCGGCTGCT
GGCcaagtct ggcatcggcg acgagtccta catgccgcgc tgcgtgttcg agccgggcac caactgcgcc accatgaagg
aaggccgcgc cgaggcgtcc gccgccatgt tcgccgcgct ggacgagctg ttcgacaagt gccgcgtccg ccccaaggac
gtcggcgtgc tcgtcgtcaa ctgcagcctc ttcaacccga cgccgtcgct gtccgccatg atcgtcaacc actacaagat
gcgcgggaac atcctcagct acaacctcgg cggcatgggg tgcagcgccg gcgtcatcgc ggtggacctc gcccgcgaca
tgctccaggc cagcggcgcg gggctcgccg tcgtcgtcag cacggaggcc gtctccttca cctggtacgc cgggaagcgc
cgctccatgc tcatccccaa cgccttcttc cgcgccggct gcgccgccgt gctgctctcc aaccgccgca gggacttcca
ccgcgccaag taccagctcg agcacatcgt gcgcacccac aagggcgccg acgaccgcag cttccggtcg gtgtaccagg
aggaggacga gcagcggatc aagggcctgt ccatcagccg cgacctcgtg gaggtcggcg gccacgcgct caagaccaac
atcaccaccc tgggcccgct cgtgcttccg ttctcggagc agatcctctt cttcgccggc gtgctcttcc gccacctgtt
cccgtccaag acctccgccc cgccgccgcc gtccgccgac ggcgacgcct ccgccgccgc tccctacatc ccggacttca
agcgcgcgtt cgagcacttc tgcatgcacg cggcgagccg cgacgtgctg gagcacctgc agggcaacct gggcctccgc
gacggcgacc tggaggcgtc gcgcgccgcg ctccaccgct tcggcaacac gtcgagcagc agcatctggt acgagctggc
gtacctggag gccaagggcc gcgtccgccg cggcgaccgc gtgtggcagc tcgccttcgg ctccgggttc aagtgcaaca
gcgccgtgtg gcgcgccgtc cgccgcgtgc gccgcccggc gcgcagcccg tggctggact gcgtcgagca gtacccgGCT
CGCATGAACG CTTAAGCTGC AGTGGTAAGT ATGCAGAGGC TAATGAACGG AAAATTACTG CAACGTCAAA AGACGGGATC
GGCATGCGAT GCCGGTTAAG GTTCAAGCTT GATTAATTTG TGTTGGTGTA TTAGCAAGTC GGTTTATGAG CCATAGACTA
CCATAAAAGT TGTGCGAGAC ATGTGTACTG AACCAGTGTA CGCGAGTTCG GTGATATGTG AACTTATCTA CGTTTGATTC
T

Locus: Os03g0181500

Loading...

Locus: Os03g0181500

Loading...