Os03t0181500-02

Locus

Os03g0181500

Description

Similar to (Rice Genome Annotation Project) fiddlehead-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ONI1

CGSNL Gene Name

ONION 1

Oryzabase Gene Symbol Synonym(s)

OsONI1

Oryzabase Gene Name Synonym(s)

ONION1

Transcript Evidence

AK100798 (DDBJ, Best hit)

Protein Evidence

Q10QW0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Biological Process: lipid biosynthetic process (GO:0008610)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

Functional domain (InterPro)

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (IPR013747)

Thiolase-like, subgroup (IPR016038)

Thiolase-like (IPR016039)

Full-length cDNA

J023121F20 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0181500-02)

Others

Oryzabase (12365)

KEGG (Os03t0181500-02)

Transcript

662 bp

>Os03t0181500-02 Similar to (Rice Genome Annotation Project) fiddlehead-like protein.
gctcttccgccacctgttcccgtccaagacctccgccccgccgccgccgtccgccgacgg
cgacgcctccgccgccgctccctacatcccggacttcaagcgcgcgttcgagcacttctg
catgcacgcggcgagccgcgacgtgctggagcacctgcagggcaacctgggcctccgcga
cggcgacctggaggcgtcgcgcgccgcgctccaccgcttcggcaacacgtcgagcagcag
catctggtacgagctggcgtacctggaggccaagggccgcgtccgccgcggcgaccgcgt
gtggcagctcgccttcggctccgggttcaagtgcaacagcgccgtgtggcgcgccgtccg
ccgcgtgcgccgcccggcgcgcagcccgtggctggactgcgtcgagcagtacccgGCTCG
CATGAACGCTTAAGCTGCAGTGGTAAGTATGCAGAGGCTAATGAACGGAAAATTACTGCA
ACGTCAAAAGACGGGATCGGCATGCGATGCCGGTTAAGGTTCAAGCTTGATTAATTTGTG
TTGGTGTATTAGCAAGTCGGTTTATGAGCCATAGACTACCATAAAAGTTGTGCGAGACAT
GTGTACTGAACCAGTGTACGCGAGTTCGGTGATATGTGAACTTATCTACGTTTGATTCTA
TT

CDS

432 bp

>Os03t0181500-02 Similar to (Rice Genome Annotation Project) fiddlehead-like protein.
ctcttccgccacctgttcccgtccaagacctccgccccgccgccgccgtccgccgacggc
gacgcctccgccgccgctccctacatcccggacttcaagcgcgcgttcgagcacttctgc
atgcacgcggcgagccgcgacgtgctggagcacctgcagggcaacctgggcctccgcgac
ggcgacctggaggcgtcgcgcgccgcgctccaccgcttcggcaacacgtcgagcagcagc
atctggtacgagctggcgtacctggaggccaagggccgcgtccgccgcggcgaccgcgtg
tggcagctcgccttcggctccgggttcaagtgcaacagcgccgtgtggcgcgccgtccgc
cgcgtgcgccgcccggcgcgcagcccgtggctggactgcgtcgagcagtacccgGCTCGC
ATGAACGCTTAA

Protein

144 aa

>Os03t0181500-02 Similar to (Rice Genome Annotation Project) fiddlehead-like protein.
LFRHLFPSKTSAPPPPSADGDASAAAPYIPDFKRAFEHFCMHAASRDVLEHLQGNLGLRD
GDLEASRAALHRFGNTSSSSIWYELAYLEAKGRVRRGDRVWQLAFGSGFKCNSAVWRAVR
RVRRPARSPWLDCVEQYPARMNA*

5'UTR

chr03:4271120..4271120 (+ strand) : 1 bp

CDS

chr03:4271121..4271552 (+ strand) : 432 bp

3'UTR

chr03:4271553..4271781 (+ strand) : 229 bp

FASTA

>Os03t0181500-02 class=Sequence position=chr03:4271120..4271781 (+ strand)
gctcttccgc cacctgttcc cgtccaagac ctccgccccg ccgccgccgt ccgccgacgg cgacgcctcc gccgccgctc
cctacatccc ggacttcaag cgcgcgttcg agcacttctg catgcacgcg gcgagccgcg acgtgctgga gcacctgcag
ggcaacctgg gcctccgcga cggcgacctg gaggcgtcgc gcgccgcgct ccaccgcttc ggcaacacgt cgagcagcag
catctggtac gagctggcgt acctggaggc caagggccgc gtccgccgcg gcgaccgcgt gtggcagctc gccttcggct
ccgggttcaa gtgcaacagc gccgtgtggc gcgccgtccg ccgcgtgcgc cgcccggcgc gcagcccgtg gctggactgc
gtcgagcagt acccgGCTCG CATGAACGCT TAAGCTGCAG TGGTAAGTAT GCAGAGGCTA ATGAACGGAA AATTACTGCA
ACGTCAAAAG ACGGGATCGG CATGCGATGC CGGTTAAGGT TCAAGCTTGA TTAATTTGTG TTGGTGTATT AGCAAGTCGG
TTTATGAGCC ATAGACTACC ATAAAAGTTG TGCGAGACAT GTGTACTGAA CCAGTGTACG CGAGTTCGGT GATATGTGAA
CTTATCTACG TTTGATTCTA TT

Locus: Os03g0181500

Loading...

Locus: Os03g0181500

Loading...