Os03t0181600-01

Locus

Os03g0181600

Description

Similar to cDNA clone:J033068D01, full insert sequence.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GATA22

CGSNL Gene Name

GATA TRANSCRIPTION FACTOR 22

Oryzabase Gene Symbol Synonym(s)

OsGATA22

Oryzabase Gene Name Synonym(s)

GATA transcription factor 22, GATA factor 22

Transcript Evidence

AK101197 (DDBJ, Best hit)

Protein Evidence

B8A2M6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Zinc finger, GATA-type (IPR000679)

FAR1 DNA binding domain (IPR004330)

Zinc finger, NHR/GATA-type (IPR013088)

MULE transposase domain (IPR018289)

Full-length cDNA

J033030K10 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0181600-01)

Others

Oryzabase (20501)

Transcript

1878 bp

>Os03t0181600-01 Similar to cDNA clone:J033068D01, full insert sequence.
AGAGCGTTCGTCACTCGCATCTCCTCCGCCTCCGGTATCCAACCTCCCGCACCAAATCCC
AATCCGGATCCCCCACGCTAAACCCTAGCTTTAAACCCCCGAATCCAACCAATCCCCGCG
CCGATTCCCGCCATTTCGCGCACCTCGTGCCAGGATCTGCTCCTGGGCGGCGCTCTTTTA
GAAAAAAACCTGGCAGATTTCGACTTCTGCAATGGAGCCCGTCGATTTCGGTGGGGGCAA
AGGTTATGGAAGGAATCTCTGTCTGAGCAACGATCTGATCCTTCTGGAGTAAGGTTTTGT
GCTGGGTGGATTTGGGATTCGATGTGGCTGGAGTTGAGCTCATCTCGGGGAGAAGGGATT
CGGACGGTGTTTGATCTTTCTGTCGTGATTGCTTTGCTTCGGGTTTGCTCAGCGCTAGAA
GATTTGCTCGCAGAATCCCGCGCGGAGTTTTGAAGAAAGCTTGGTATTTCCTGGTTCGTT
GTGGTTTGTAAGCGATGCAGTTCGAGGACGGGGGAGATGTTCATGTTGGTGCCGGTGAGG
GTGAAGATGGTGGCAGGGTCACAGTGGATGAGCTTACCAGATGTCTACGTTGTGGCATCA
GTGCAAATGCGACGCCTCATATGCGCCGTGGACCAGAGGGACGGAGAACTTTATGCAATG
CTTGTGGTATAGCATGGGCAAAGGGAAAAGTGCGAAAAGTTATTGATTCTGATACCCCCA
TGGATAATGCCATGTTTGCACAAATGGTTCCAGAACTTAGCATGGAATTCGATGACGAAG
ATAAAGCATATGAGTTCTACAACAGGTACGCTGGACATGTGGGATTCAGTGTTCGTAAAA
GTTCATCGGACAAATCAGCTGAAAACATCACAAGGTCAAGAACCTTTGTATGCTCGAGAG
AAGGTTTTCGTAAGGACAAGAAAGGAGCTAAGGAAGTTAAAAGACCACGGCCAGAAACAA
GAATAGGGTGTCCTGCACGAATGTCAATTAAGATTACATCTGATGGTAAATATCGTATAT
CTGAATTCGTACCAGATCATAACCATCAGCCAGCACCCCCATCAACCATGCATATGCTGA
GGTCTCAGAGAGTACTCACTGAGCTGCAAACAACTGAAGCAGACTCCTCAGAAGAATCAG
CGACACCATCAAGGTTTTCTAGTTGCTCTTTGGTGAAGCAAGCAGAAGTAATTAGACATA
CCAATTTTCTCCCTGCAGAATACAGGTGCTCTCTTTGTTCAAAGCGCAAGAAAAATATGC
AACCTGGTGATGCAGGAGTAACTGTAAAGTACCTGCAAAGCAtgcagctaagcaaccctt
ctttcttttatgctgtccagcttgatgaggatgacaaactgacaaacattttctgggccg
attccaaatctagaaccgacttcagctactacagtgacgtggtttgtttggacacaacct
acaagataaatgaacatagcagaccattaacactattccttggagtgaaccaccacaagc
aaatctccatatttggtgctgccttgctttatgatgaatcagaagagtctttcaagtggc
tatttgatacattcaagattgctgcaaatggaaagcaaccaaaaacaatcttgacagatT
GGTCTATGGCAGCAACTACGGCTTCTGCGATAACAGCAGCATGGCCTGGAACAGTTCATC
GCCTTTGTCCATGGCAAGTGTACCAAAACTCTGTCAAGCACCTTAATCACATCTTTCAAG
GCTCCAAAACATTTGCAAAGGATTTCGGAAAATGCGTTTATGACTACGATGATGAAGAGA
ACTTCTTGCTTGGATGGAATACTATGCTAGAGAAGTATGATCTACGAAACAATGAGTGGA
TTAAAAAAATATTTGATG

CDS

1384 bp

>Os03t0181600-01 Similar to cDNA clone:J033068D01, full insert sequence.
ATGCAGTTCGAGGACGGGGGAGATGTTCATGTTGGTGCCGGTGAGGGTGAAGATGGTGGC
AGGGTCACAGTGGATGAGCTTACCAGATGTCTACGTTGTGGCATCAGTGCAAATGCGACG
CCTCATATGCGCCGTGGACCAGAGGGACGGAGAACTTTATGCAATGCTTGTGGTATAGCA
TGGGCAAAGGGAAAAGTGCGAAAAGTTATTGATTCTGATACCCCCATGGATAATGCCATG
TTTGCACAAATGGTTCCAGAACTTAGCATGGAATTCGATGACGAAGATAAAGCATATGAG
TTCTACAACAGGTACGCTGGACATGTGGGATTCAGTGTTCGTAAAAGTTCATCGGACAAA
TCAGCTGAAAACATCACAAGGTCAAGAACCTTTGTATGCTCGAGAGAAGGTTTTCGTAAG
GACAAGAAAGGAGCTAAGGAAGTTAAAAGACCACGGCCAGAAACAAGAATAGGGTGTCCT
GCACGAATGTCAATTAAGATTACATCTGATGGTAAATATCGTATATCTGAATTCGTACCA
GATCATAACCATCAGCCAGCACCCCCATCAACCATGCATATGCTGAGGTCTCAGAGAGTA
CTCACTGAGCTGCAAACAACTGAAGCAGACTCCTCAGAAGAATCAGCGACACCATCAAGG
TTTTCTAGTTGCTCTTTGGTGAAGCAAGCAGAAGTAATTAGACATACCAATTTTCTCCCT
GCAGAATACAGGTGCTCTCTTTGTTCAAAGCGCAAGAAAAATATGCAACCTGGTGATGCA
GGAGTAACTGTAAAGTACCTGCAAAGCAtgcagctaagcaacccttctttcttttatgct
gtccagcttgatgaggatgacaaactgacaaacattttctgggccgattccaaatctaga
accgacttcagctactacagtgacgtggtttgtttggacacaacctacaagataaatgaa
catagcagaccattaacactattccttggagtgaaccaccacaagcaaatctccatattt
ggtgctgccttgctttatgatgaatcagaagagtctttcaagtggctatttgatacattc
aagattgctgcaaatggaaagcaaccaaaaacaatcttgacagatTGGTCTATGGCAGCA
ACTACGGCTTCTGCGATAACAGCAGCATGGCCTGGAACAGTTCATCGCCTTTGTCCATGG
CAAGTGTACCAAAACTCTGTCAAGCACCTTAATCACATCTTTCAAGGCTCCAAAACATTT
GCAAAGGATTTCGGAAAATGCGTTTATGACTACGATGATGAAGAGAACTTCTTGCTTGGA
TGGAATACTATGCTAGAGAAGTATGATCTACGAAACAATGAGTGGATTAAAAAAATATTT
GATG

Protein

460 aa

>Os03t0181600-01 Similar to cDNA clone:J033068D01, full insert sequence.
MQFEDGGDVHVGAGEGEDGGRVTVDELTRCLRCGISANATPHMRRGPEGRRTLCNACGIA
WAKGKVRKVIDSDTPMDNAMFAQMVPELSMEFDDEDKAYEFYNRYAGHVGFSVRKSSSDK
SAENITRSRTFVCSREGFRKDKKGAKEVKRPRPETRIGCPARMSIKITSDGKYRISEFVP
DHNHQPAPPSTMHMLRSQRVLTELQTTEADSSEESATPSRFSSCSLVKQAEVIRHTNFLP
AEYRCSLCSKRKKNMQPGDAGVTVKYLQSMQLSNPSFFYAVQLDEDDKLTNIFWADSKSR
TDFSYYSDVVCLDTTYKINEHSRPLTLFLGVNHHKQISIFGAALLYDESEESFKWLFDTF
KIAANGKQPKTILTDWSMAATTASAITAAWPGTVHRLCPWQVYQNSVKHLNHIFQGSKTF
AKDFGKCVYDYDDEENFLLGWNTMLEKYDLRNNEWIKKIFD

5'UTR

chr03:4272872..4273365 (+ strand) : 494 bp

CDS

chr03:4273366..4273451 (+ strand) : 86 bp

chr03:4274264..4274366 (+ strand) : 103 bp

chr03:4274448..4275642 (+ strand) : 1195 bp

FASTA

>Os03t0181600-01 class=Sequence position=chr03:4272872..4275642 (+ strand)
AGAGCGTTCG TCACTCGCAT CTCCTCCGCC TCCGGTATCC AACCTCCCGC ACCAAATCCC AATCCGGATC CCCCACGCTA
AACCCTAGCT TTAAACCCCC GAATCCAACC AATCCCCGCG CCGATTCCCG CCATTTCGCG CACCTCGTGC CAGGATCTGC
TCCTGGGCGG CGCTCTTTTA GAAAAAAACC TGGCAGATTT CGACTTCTGC AATGGAGCCC GTCGATTTCG GTGGGGGCAA
AGGTTATGGA AGGAATCTCT GTCTGAGCAA CGATCTGATC CTTCTGGAGT AAGGTTTTGT GCTGGGTGGA TTTGGGATTC
GATGTGGCTG GAGTTGAGCT CATCTCGGGG AGAAGGGATT CGGACGGTGT TTGATCTTTC TGTCGTGATT GCTTTGCTTC
GGGTTTGCTC AGCGCTAGAA GATTTGCTCG CAGAATCCCG CGCGGAGTTT TGAAGAAAGC TTGGTATTTC CTGGTTCGTT
GTGGTTTGTA AGCGATGCAG TTCGAGGACG GGGGAGATGT TCATGTTGGT GCCGGTGAGG GTGAAGATGG TGGCAGGGTC
ACAGTGGATG AGCTTACCAG GTGAAGAATT TTTCTTTCTT TTTTATTTTT ACCGTATCCT ACATTCAGCA GTTCAGCATC
GAGATTTCAT ATGTGCAATG TTTGGGTGAA AAGCTAACGT GCCAAGCTAG TTATAACTGT AGCTAGGGCC TACCCTCCAT
AATATAGTTT TTTTTTTTTG AAACCGtccc tccataatat agtgacctag taacggacga gacatttcat agtacaataa
atctaacatg ctcttgtcta gatttattgt actatgaaat attgaaatgt ctcatccagt actaagttgc tatattatta
gacggaggga gTACGAGATA TCACGAGAGA AGAGAGCTCT GGATGTTAGT ACTATTTAGT ACCCTTTTGC AGTTCTTTTC
TTTTCCCAAT TCTAGTCTTC TGTAGTTATG GTTAAGCGAG ACCGGATTCA AATTTAGAAG AGTAACACTT CCTCAAGTCA
GTATTACTTG TCGTTTCAGA CAGGGAAATA CTACTAAGTG CAAATCAATT CCACTACCTG AAACATCATA TATTTCCGTC
CGGAGGGAGT AGTAGCTGAT CATCAATGCC TTTTCTCAGA TCGGGTTATG AAAGCAATAA AATTATCAAA GGCTGTCTGT
CGGTCCATGC ATATGGTGGA ATGTTAGTAT TGCACACTGA CTACTTAGCA GGTTGGTGAC TACTATACTA CTCAGTACTA
TCAACATTCA GCAGCATGCT GGAAATTGAT ACAGATCATT TTCTCTTGAA TCAAGGACTC AATTATTCAT GGTAGTGAGA
CGATTCCTAA CTTTTATGTT ATAGTTTTTC AGATGTCTAC GTTGTGGCAT CAGTGCAAAT GCGACGCCTC ATATGCGCCG
TGGACCAGAG GGACGGAGAA CTTTATGCAA TGCTTGTGGT ATAGCATGGG CAAAGGTATT CTAATTGTTC TCCACCACTT
CTTGTTTAta ctcgctccaa ttccaaatgt aagtcgtttt ggttttctac atgcaGGGAA AAGTGCGAAA AGTTATTGAT
TCTGATACCC CCATGGATAA TGCCATGTTT GCACAAATGG TTCCAGAACT TAGCATGGAA TTCGATGACG AAGATAAAGC
ATATGAGTTC TACAACAGGT ACGCTGGACA TGTGGGATTC AGTGTTCGTA AAAGTTCATC GGACAAATCA GCTGAAAACA
TCACAAGGTC AAGAACCTTT GTATGCTCGA GAGAAGGTTT TCGTAAGGAC AAGAAAGGAG CTAAGGAAGT TAAAAGACCA
CGGCCAGAAA CAAGAATAGG GTGTCCTGCA CGAATGTCAA TTAAGATTAC ATCTGATGGT AAATATCGTA TATCTGAATT
CGTACCAGAT CATAACCATC AGCCAGCACC CCCATCAACC ATGCATATGC TGAGGTCTCA GAGAGTACTC ACTGAGCTGC
AAACAACTGA AGCAGACTCC TCAGAAGAAT CAGCGACACC ATCAAGGTTT TCTAGTTGCT CTTTGGTGAA GCAAGCAGAA
GTAATTAGAC ATACCAATTT TCTCCCTGCA GAATACAGGT GCTCTCTTTG TTCAAAGCGC AAGAAAAATA TGCAACCTGG
TGATGCAGGA GTAACTGTAA AGTACCTGCA AAGCAtgcag ctaagcaacc cttctttctt ttatgctgtc cagcttgatg
aggatgacaa actgacaaac attttctggg ccgattccaa atctagaacc gacttcagct actacagtga cgtggtttgt
ttggacacaa cctacaagat aaatgaacat agcagaccat taacactatt ccttggagtg aaccaccaca agcaaatctc
catatttggt gctgccttgc tttatgatga atcagaagag tctttcaagt ggctatttga tacattcaag attgctgcaa
atggaaagca accaaaaaca atcttgacag atTGGTCTAT GGCAGCAACT ACGGCTTCTG CGATAACAGC AGCATGGCCT
GGAACAGTTC ATCGCCTTTG TCCATGGCAA GTGTACCAAA ACTCTGTCAA GCACCTTAAT CACATCTTTC AAGGCTCCAA
AACATTTGCA AAGGATTTCG GAAAATGCGT TTATGACTAC GATGATGAAG AGAACTTCTT GCTTGGATGG AATACTATGC
TAGAGAAGTA TGATCTACGA AACAATGAGT GGATTAAAAA AATATTTGAT G

Locus: Os03g0181600

Loading...

Locus: Os03g0181600

Loading...