Os03t0181600-02

Locus

Os03g0181600

Description

Similar to GATA transcription factor 25 (ZIM-like 2 protein).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GATA22

CGSNL Gene Name

GATA TRANSCRIPTION FACTOR 22

Oryzabase Gene Symbol Synonym(s)

OsGATA22

Oryzabase Gene Name Synonym(s)

GATA transcription factor 22, GATA factor 22

Transcript Evidence

AK067807 (DDBJ, Best hit)

Protein Evidence

B8A2M6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Zinc finger, GATA-type (IPR000679)

FAR1 DNA binding domain (IPR004330)

Zinc finger, PMZ-type (IPR006564)

Zinc finger, SWIM-type (IPR007527)

Zinc finger, NHR/GATA-type (IPR013088)

MULE transposase domain (IPR018289)

Full-length cDNA

J013120L22 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0181600-02)

RiceXPro (AK067807)

Others

Oryzabase (20501)

KEGG (Os03t0181600-02)

Transcript

3098 bp

>Os03t0181600-02 Similar to GATA transcription factor 25 (ZIM-like 2 protein).
GAGCGTTCGTCACTCGCATCTCCTCCGCCTCCGGTATCCAACCTCCCGCACCAAATCCCA
ATCCGGATCCCCCACGCTAAACCCTAGCTTTAAACCCCCGAATCCAACCAATCCCCGCGC
CGATTCCCGCCATTTCGCGCACCTCGTGCCAGGATCTGCTCCTGGGCGGCGCTCTTTTAG
AAAAAAACCTGGCAGATTTCGACTTCTGCAATGGAGCCCGTCGATTTCGGTGGGGGCAAA
GGTTATGGAAGGAATCTCTGTCTGAGCAACGATCTGATCCTTCTGGAGTAAGGTTTTGTG
CTGGGTGGATTTGGGATTCGATGTGGCTGGAGTTGAGCTCATCTCGGGGAGAAGGGATTC
GGACGGTGTTTGATCTTTCTGTCGTGATTGCTTTGCTTCGGGTTTGCTCAGCGCTAGAAG
ATTTGCTCGCAGAATCCCGCGCGGAGTTTTGAAGAAAGCTTGGTATTTCCTGGTTCGTTG
TGGTTTGTAAGCGATGCAGTTCGAGGACGGGGGAGATGTTCATGTTGGTGCCGGTGAGGG
TGAAGATGGTGGCAGGGTCACAGTGGATGAGCTTACCAGATGTCTACGTTGTGGCATCAG
TGCAAATGCGACGCCTCATATGCGCCGTGGACCAGAGGGACGGAGAACTTTATGCAATGC
TTGTGGTATAGCATGGGCAAAGGGAAAAGTGCGAAAAGTTATTGATTCTGATACCCCCAT
GGATAATGCCATGTTTGCACAAATGGTTCCAGAACTTAGCATGGAATTCGATGACGAAGA
TAAAGCATATGAGTTCTACAACAGGTACGCTGGACATGTGGGATTCAGTGTTCGTAAAAG
TTCATCGGACAAATCAGCTGAAAACATCACAAGGTCAAGAACCTTTGTATGCTCGAGAGA
AGGTTTTCGTAAGGACAAGAAAGGAGCTAAGGAAGTTAAAAGACCACGGCCAGAAACAAG
AATAGGGTGTCCTGCACGAATGTCAATTAAGATTACATCTGATGGTAAATATCGTATATC
TGAATTCGTACCAGATCATAACCATCAGCCAGCACCCCCATCAACCATGCATATGCTGAG
GTCTCAGAGAGTACTCACTGAGCTGCAAACAACTGAAGCAGACTCCTCAGAAGAATCAGC
GACACCATCAAGGTTTTCTAGTTGCTCTTTGGTGAAGCAAGCAGAAGTAATTAGACATAC
CAATTTTCTCCCTGCAGAATACAGGTGCTCTCTTTGTTCAAAGCGCAAGAAAAATATGCA
ACCTGGTGATGCAGGAGTAACTGTAAAGTACCTGCAAAGCAtgcagctaagcaacccttc
tttcttttatgctgtccagcttgatgaggatgacaaactgacaaacattttctgggccga
ttccaaatctagaaccgacttcagctactacagtgacgtggtttgtttggacacaaccta
caagataaatgaacatagcagaccattaacactattccttggagtgaaccaccacaagca
aatctccatatttggtgctgccttgctttatgatgaatcagaagagtctttcaagtggct
atttgatacattcaagattgctgcaaatggaaagcaaccaaaaacaatcttgacagatTG
GTCTATGGCAGCAACTACGGCTTCTGCGATAACAGCAGCATGGCCTGGAACAGTTCATCG
CCTTTGTCCATGGCAAGTGTACCAAAACTCTGTCAAGCACCTTAATCACATCTTTCAAGG
CTCCAAAACATTTGCAAAGGATTTCGGAAAATGCGTTTATGACTACGATGATGAAGAGAA
CTTCTTGCTTGGATGGAATACTATGCTAGAGAAGTATGATCTACGAAACAATGAGTGGAT
TAAAAAAATATTTGATGATCGTGATAAATGGTCTCCAGTATACAATCGCCATGTATTCAC
TGCAGATATAAAAAGTTCTTTGCAGTCGGAAAGTGTTAGAAATGCCTTGAAGAAGTCCTT
GAGTCCACAATTTGACCTGTTATCTTTCTTTAAGCACTATGAAAGAATGCTTGATGAGTT
TCGTTATGCAGAGTTACAAGCTGATTTTCATGCAAGCCAAAGCTTCCCTAGAATTCCTCC
ATCCAAAATGCTGAGACAGGCTGCTAACATGTACACACCAGTGGTCTTTGAAATTTTTCG
CAGGGAGTTTGAGATGTTTGTCGATTCCGTGATTTATAGCTGTGGAGAGGATGGAAATGC
ATTCGAATATAGAGTAGCAGTAACAGATAGGCCTGGGGAACACTATGTTAGGTTTGACTC
TGGCGACTTATCTGTTGTATGCAGTTGTAAAAAATTTGAAGCAATGGGTATCCAGTGTTG
CCATGTGTTGAAAGTTCTAGATTTCAGAAATATAAAGGAGTTACCACAAAAATATTTCAT
GAAAAGATGGAAGAAGGATGTCAAGTCTGCAAGTACAGGCAATCAAGAACTTCTGAATGG
AGGAGTTTCACAAATTCCCAGCTCTTATTTGAATGTTCCCGTGCCATTTATAGATCCACA
ACATGTGCAATCAAATAACGAGCTTAACCATGACACTTCTGTTTCTAACTCCCACCAGCA
GGCCCTTCATGGAGGTGCACAGGGAAGTCAGGGTTATGCTCCCTTAGCAGGGATTCAGCA
GCAGCAGTTTATTGGAAATTTTCGCCTGAACCATGAAACAGGTTTCTTATGAAAAACAGA
ACTGGCGCTTTTGCCCTGTTCTTGTCTTCCAAAAACTTTTTTGCTCTGTTATTCCAAAGA
CAATGACACAAGACATCGAAACAGTCTCTAGTCTCTACCTTTACATCTCCCTTGTAAATT
CTAATTCATATTTCGTAGCATCACAAATATACAAGCTCAATAGTTTTCAGGAAACTACGT
TCAGAGTTTAAACGCTGTTGGACCTTGGAGGAAGTACCCGCTAAGACATAAGTCTGATTA
TTGGCCTAAAATAAGGTTGTATTATTAGCATATGTGATGTAGTATATACAGACATACAGT
TCGTAGTTCTGGTGATTTTGCAGAAGCTTTCAATTGCTTCGCTGCCAAATGGCCACTTCA
ACCATGCACTCTTTTAATCTAATGCTCTCACTGTTTCC

CDS

2199 bp

>Os03t0181600-02 Similar to GATA transcription factor 25 (ZIM-like 2 protein).
ATGCAGTTCGAGGACGGGGGAGATGTTCATGTTGGTGCCGGTGAGGGTGAAGATGGTGGC
AGGGTCACAGTGGATGAGCTTACCAGATGTCTACGTTGTGGCATCAGTGCAAATGCGACG
CCTCATATGCGCCGTGGACCAGAGGGACGGAGAACTTTATGCAATGCTTGTGGTATAGCA
TGGGCAAAGGGAAAAGTGCGAAAAGTTATTGATTCTGATACCCCCATGGATAATGCCATG
TTTGCACAAATGGTTCCAGAACTTAGCATGGAATTCGATGACGAAGATAAAGCATATGAG
TTCTACAACAGGTACGCTGGACATGTGGGATTCAGTGTTCGTAAAAGTTCATCGGACAAA
TCAGCTGAAAACATCACAAGGTCAAGAACCTTTGTATGCTCGAGAGAAGGTTTTCGTAAG
GACAAGAAAGGAGCTAAGGAAGTTAAAAGACCACGGCCAGAAACAAGAATAGGGTGTCCT
GCACGAATGTCAATTAAGATTACATCTGATGGTAAATATCGTATATCTGAATTCGTACCA
GATCATAACCATCAGCCAGCACCCCCATCAACCATGCATATGCTGAGGTCTCAGAGAGTA
CTCACTGAGCTGCAAACAACTGAAGCAGACTCCTCAGAAGAATCAGCGACACCATCAAGG
TTTTCTAGTTGCTCTTTGGTGAAGCAAGCAGAAGTAATTAGACATACCAATTTTCTCCCT
GCAGAATACAGGTGCTCTCTTTGTTCAAAGCGCAAGAAAAATATGCAACCTGGTGATGCA
GGAGTAACTGTAAAGTACCTGCAAAGCAtgcagctaagcaacccttctttcttttatgct
gtccagcttgatgaggatgacaaactgacaaacattttctgggccgattccaaatctaga
accgacttcagctactacagtgacgtggtttgtttggacacaacctacaagataaatgaa
catagcagaccattaacactattccttggagtgaaccaccacaagcaaatctccatattt
ggtgctgccttgctttatgatgaatcagaagagtctttcaagtggctatttgatacattc
aagattgctgcaaatggaaagcaaccaaaaacaatcttgacagatTGGTCTATGGCAGCA
ACTACGGCTTCTGCGATAACAGCAGCATGGCCTGGAACAGTTCATCGCCTTTGTCCATGG
CAAGTGTACCAAAACTCTGTCAAGCACCTTAATCACATCTTTCAAGGCTCCAAAACATTT
GCAAAGGATTTCGGAAAATGCGTTTATGACTACGATGATGAAGAGAACTTCTTGCTTGGA
TGGAATACTATGCTAGAGAAGTATGATCTACGAAACAATGAGTGGATTAAAAAAATATTT
GATGATCGTGATAAATGGTCTCCAGTATACAATCGCCATGTATTCACTGCAGATATAAAA
AGTTCTTTGCAGTCGGAAAGTGTTAGAAATGCCTTGAAGAAGTCCTTGAGTCCACAATTT
GACCTGTTATCTTTCTTTAAGCACTATGAAAGAATGCTTGATGAGTTTCGTTATGCAGAG
TTACAAGCTGATTTTCATGCAAGCCAAAGCTTCCCTAGAATTCCTCCATCCAAAATGCTG
AGACAGGCTGCTAACATGTACACACCAGTGGTCTTTGAAATTTTTCGCAGGGAGTTTGAG
ATGTTTGTCGATTCCGTGATTTATAGCTGTGGAGAGGATGGAAATGCATTCGAATATAGA
GTAGCAGTAACAGATAGGCCTGGGGAACACTATGTTAGGTTTGACTCTGGCGACTTATCT
GTTGTATGCAGTTGTAAAAAATTTGAAGCAATGGGTATCCAGTGTTGCCATGTGTTGAAA
GTTCTAGATTTCAGAAATATAAAGGAGTTACCACAAAAATATTTCATGAAAAGATGGAAG
AAGGATGTCAAGTCTGCAAGTACAGGCAATCAAGAACTTCTGAATGGAGGAGTTTCACAA
ATTCCCAGCTCTTATTTGAATGTTCCCGTGCCATTTATAGATCCACAACATGTGCAATCA
AATAACGAGCTTAACCATGACACTTCTGTTTCTAACTCCCACCAGCAGGCCCTTCATGGA
GGTGCACAGGGAAGTCAGGGTTATGCTCCCTTAGCAGGGATTCAGCAGCAGCAGTTTATT
GGAAATTTTCGCCTGAACCATGAAACAGGTTTCTTATGA

Protein

732 aa

>Os03t0181600-02 Similar to GATA transcription factor 25 (ZIM-like 2 protein).
MQFEDGGDVHVGAGEGEDGGRVTVDELTRCLRCGISANATPHMRRGPEGRRTLCNACGIA
WAKGKVRKVIDSDTPMDNAMFAQMVPELSMEFDDEDKAYEFYNRYAGHVGFSVRKSSSDK
SAENITRSRTFVCSREGFRKDKKGAKEVKRPRPETRIGCPARMSIKITSDGKYRISEFVP
DHNHQPAPPSTMHMLRSQRVLTELQTTEADSSEESATPSRFSSCSLVKQAEVIRHTNFLP
AEYRCSLCSKRKKNMQPGDAGVTVKYLQSMQLSNPSFFYAVQLDEDDKLTNIFWADSKSR
TDFSYYSDVVCLDTTYKINEHSRPLTLFLGVNHHKQISIFGAALLYDESEESFKWLFDTF
KIAANGKQPKTILTDWSMAATTASAITAAWPGTVHRLCPWQVYQNSVKHLNHIFQGSKTF
AKDFGKCVYDYDDEENFLLGWNTMLEKYDLRNNEWIKKIFDDRDKWSPVYNRHVFTADIK
SSLQSESVRNALKKSLSPQFDLLSFFKHYERMLDEFRYAELQADFHASQSFPRIPPSKML
RQAANMYTPVVFEIFRREFEMFVDSVIYSCGEDGNAFEYRVAVTDRPGEHYVRFDSGDLS
VVCSCKKFEAMGIQCCHVLKVLDFRNIKELPQKYFMKRWKKDVKSASTGNQELLNGGVSQ
IPSSYLNVPVPFIDPQHVQSNNELNHDTSVSNSHQQALHGGAQGSQGYAPLAGIQQQQFI
GNFRLNHETGFL*

5'UTR

chr03:4272873..4273365 (+ strand) : 493 bp

CDS

chr03:4273366..4273451 (+ strand) : 86 bp

chr03:4274264..4274366 (+ strand) : 103 bp

chr03:4274448..4276316 (+ strand) : 1869 bp

chr03:4276402..4276461 (+ strand) : 60 bp

chr03:4276980..4277060 (+ strand) : 81 bp

3'UTR

chr03:4277061..4277466 (+ strand) : 406 bp

FASTA

>Os03t0181600-02 class=Sequence position=chr03:4272873..4277466 (+ strand)
GAGCGTTCGT CACTCGCATC TCCTCCGCCT CCGGTATCCA ACCTCCCGCA CCAAATCCCA ATCCGGATCC CCCACGCTAA
ACCCTAGCTT TAAACCCCCG AATCCAACCA ATCCCCGCGC CGATTCCCGC CATTTCGCGC ACCTCGTGCC AGGATCTGCT
CCTGGGCGGC GCTCTTTTAG AAAAAAACCT GGCAGATTTC GACTTCTGCA ATGGAGCCCG TCGATTTCGG TGGGGGCAAA
GGTTATGGAA GGAATCTCTG TCTGAGCAAC GATCTGATCC TTCTGGAGTA AGGTTTTGTG CTGGGTGGAT TTGGGATTCG
ATGTGGCTGG AGTTGAGCTC ATCTCGGGGA GAAGGGATTC GGACGGTGTT TGATCTTTCT GTCGTGATTG CTTTGCTTCG
GGTTTGCTCA GCGCTAGAAG ATTTGCTCGC AGAATCCCGC GCGGAGTTTT GAAGAAAGCT TGGTATTTCC TGGTTCGTTG
TGGTTTGTAA GCGATGCAGT TCGAGGACGG GGGAGATGTT CATGTTGGTG CCGGTGAGGG TGAAGATGGT GGCAGGGTCA
CAGTGGATGA GCTTACCAGG TGAAGAATTT TTCTTTCTTT TTTATTTTTA CCGTATCCTA CATTCAGCAG TTCAGCATCG
AGATTTCATA TGTGCAATGT TTGGGTGAAA AGCTAACGTG CCAAGCTAGT TATAACTGTA GCTAGGGCCT ACCCTCCATA
ATATAGTTTT TTTTTTTTGA AACCGtccct ccataatata gtgacctagt aacggacgag acatttcata gtacaataaa
tctaacatgc tcttgtctag atttattgta ctatgaaata ttgaaatgtc tcatccagta ctaagttgct atattattag
acggagggag TACGAGATAT CACGAGAGAA GAGAGCTCTG GATGTTAGTA CTATTTAGTA CCCTTTTGCA GTTCTTTTCT
TTTCCCAATT CTAGTCTTCT GTAGTTATGG TTAAGCGAGA CCGGATTCAA ATTTAGAAGA GTAACACTTC CTCAAGTCAG
TATTACTTGT CGTTTCAGAC AGGGAAATAC TACTAAGTGC AAATCAATTC CACTACCTGA AACATCATAT ATTTCCGTCC
GGAGGGAGTA GTAGCTGATC ATCAATGCCT TTTCTCAGAT CGGGTTATGA AAGCAATAAA ATTATCAAAG GCTGTCTGTC
GGTCCATGCA TATGGTGGAA TGTTAGTATT GCACACTGAC TACTTAGCAG GTTGGTGACT ACTATACTAC TCAGTACTAT
CAACATTCAG CAGCATGCTG GAAATTGATA CAGATCATTT TCTCTTGAAT CAAGGACTCA ATTATTCATG GTAGTGAGAC
GATTCCTAAC TTTTATGTTA TAGTTTTTCA GATGTCTACG TTGTGGCATC AGTGCAAATG CGACGCCTCA TATGCGCCGT
GGACCAGAGG GACGGAGAAC TTTATGCAAT GCTTGTGGTA TAGCATGGGC AAAGGTATTC TAATTGTTCT CCACCACTTC
TTGTTTAtac tcgctccaat tccaaatgta agtcgttttg gttttctaca tgcaGGGAAA AGTGCGAAAA GTTATTGATT
CTGATACCCC CATGGATAAT GCCATGTTTG CACAAATGGT TCCAGAACTT AGCATGGAAT TCGATGACGA AGATAAAGCA
TATGAGTTCT ACAACAGGTA CGCTGGACAT GTGGGATTCA GTGTTCGTAA AAGTTCATCG GACAAATCAG CTGAAAACAT
CACAAGGTCA AGAACCTTTG TATGCTCGAG AGAAGGTTTT CGTAAGGACA AGAAAGGAGC TAAGGAAGTT AAAAGACCAC
GGCCAGAAAC AAGAATAGGG TGTCCTGCAC GAATGTCAAT TAAGATTACA TCTGATGGTA AATATCGTAT ATCTGAATTC
GTACCAGATC ATAACCATCA GCCAGCACCC CCATCAACCA TGCATATGCT GAGGTCTCAG AGAGTACTCA CTGAGCTGCA
AACAACTGAA GCAGACTCCT CAGAAGAATC AGCGACACCA TCAAGGTTTT CTAGTTGCTC TTTGGTGAAG CAAGCAGAAG
TAATTAGACA TACCAATTTT CTCCCTGCAG AATACAGGTG CTCTCTTTGT TCAAAGCGCA AGAAAAATAT GCAACCTGGT
GATGCAGGAG TAACTGTAAA GTACCTGCAA AGCAtgcagc taagcaaccc ttctttcttt tatgctgtcc agcttgatga
ggatgacaaa ctgacaaaca ttttctgggc cgattccaaa tctagaaccg acttcagcta ctacagtgac gtggtttgtt
tggacacaac ctacaagata aatgaacata gcagaccatt aacactattc cttggagtga accaccacaa gcaaatctcc
atatttggtg ctgccttgct ttatgatgaa tcagaagagt ctttcaagtg gctatttgat acattcaaga ttgctgcaaa
tggaaagcaa ccaaaaacaa tcttgacaga tTGGTCTATG GCAGCAACTA CGGCTTCTGC GATAACAGCA GCATGGCCTG
GAACAGTTCA TCGCCTTTGT CCATGGCAAG TGTACCAAAA CTCTGTCAAG CACCTTAATC ACATCTTTCA AGGCTCCAAA
ACATTTGCAA AGGATTTCGG AAAATGCGTT TATGACTACG ATGATGAAGA GAACTTCTTG CTTGGATGGA ATACTATGCT
AGAGAAGTAT GATCTACGAA ACAATGAGTG GATTAAAAAA ATATTTGATG ATCGTGATAA ATGGTCTCCA GTATACAATC
GCCATGTATT CACTGCAGAT ATAAAAAGTT CTTTGCAGTC GGAAAGTGTT AGAAATGCCT TGAAGAAGTC CTTGAGTCCA
CAATTTGACC TGTTATCTTT CTTTAAGCAC TATGAAAGAA TGCTTGATGA GTTTCGTTAT GCAGAGTTAC AAGCTGATTT
TCATGCAAGC CAAAGCTTCC CTAGAATTCC TCCATCCAAA ATGCTGAGAC AGGCTGCTAA CATGTACACA CCAGTGGTCT
TTGAAATTTT TCGCAGGGAG TTTGAGATGT TTGTCGATTC CGTGATTTAT AGCTGTGGAG AGGATGGAAA TGCATTCGAA
TATAGAGTAG CAGTAACAGA TAGGCCTGGG GAACACTATG TTAGGTTTGA CTCTGGCGAC TTATCTGTTG TATGCAGTTG
TAAAAAATTT GAAGCAATGG GTATCCAGTG TTGCCATGTG TTGAAAGTTC TAGATTTCAG AAATATAAAG GAGTTACCAC
AAAAATATTT CATGAAAAGA TGGAAGAAGG ATGTCAAGTC TGCAAGTACA GGCAATCAAG AACTTCTGAA TGGAGGAGTT
TCACAAATTC CCAGCTCTTA TTTGAATGTT CCCGTGCCAT TTATAGATCC ACAACATGTG CAATCAAATA ACGAGCTTAA
CCATGTAAGT TGATCAAATA TAACTATTCA TTAAGTTTAT TTTTTATCCT TAGTAAAGGT TGAGGTTCAA TATGCGTGAT
CAACTACAGG ACACTTCTGT TTCTAACTCC CACCAGCAGG CCCTTCATGG AGGTGCACAG GGAAGTCAGG TAAGACCCCT
TGGTAGAACT GAACTCACTT GTGCAATACT TAATTTCTAA AAGCAATATT GGTGCTTTTG CTCTTCTCAT AGTATTTTGT
ATGCACCGCC TTCTGAGGCA AGCAATCCAT TAAGTTTGTA TGCACTCAAA TTTTGTTAGA AAAATATTCT CAAGATCGCC
ACATTCCATG GTTGTATACG ATTTGAGACC ACTGGTGACA AAAGAATACG CTCACATCTT TTTGTGCATT TCTGGCTTTT
AGATATACAG AAGATTAGta ctccctccgt ttcacaatgt aagtcattct agcatttccc acattcatat tgatgttaat
gaatctagac atatatatct atctagattc attaatatca atatgtatgt gggaaatgct agaatgactt acattgtgga
acggaggaag taTCTATTAA TTGGAACACT CAATATAAGT AAATTAGACT CATGATTATA TGGAAGATTT TTTTAATTTG
CCTTTCTGAC TTTTGGTTGT TTTACAGGGT TATGCTCCCT TAGCAGGGAT TCAGCAGCAG CAGTTTATTG GAAATTTTCG
CCTGAACCAT GAAACAGGTT TCTTATGAAA AACAGAACTG GCGCTTTTGC CCTGTTCTTG TCTTCCAAAA ACTTTTTTGC
TCTGTTATTC CAAAGACAAT GACACAAGAC ATCGAAACAG TCTCTAGTCT CTACCTTTAC ATCTCCCTTG TAAATTCTAA
TTCATATTTC GTAGCATCAC AAATATACAA GCTCAATAGT TTTCAGGAAA CTACGTTCAG AGTTTAAACG CTGTTGGACC
TTGGAGGAAG TACCCGCTAA GACATAAGTC TGATTATTGG CCTAAAATAA GGTTGTATTA TTAGCATATG TGATGTAGTA
TATACAGACA TACAGTTCGT AGTTCTGGTG ATTTTGCAGA AGCTTTCAAT TGCTTCGCTG CCAAATGGCC ACTTCAACCA
TGCACTCTTT TAATCTAATG CTCTCACTGT TTCC

Locus: Os03g0181600

Loading...

Locus: Os03g0181600

Loading...