Os03t0183000-01

Locus

Os03g0183000

Description

APETALA2/ethylene-responsive element binding protein 125, Transcription regulator, Positive regulator of grain length

RAP-DB Gene Symbol Synonym(s)

OsLG3, OsAP2-125, OsLG3/OsAP2-125

RAP-DB Gene Name Synonym(s)

APETALA2/ethylene-responsive element binding protein 125

CGSNL Gene Symbol

ERF62

CGSNL Gene Name

ETHYLENE RESPONSE FACTOR 62

Oryzabase Gene Symbol Synonym(s)

OsERF#062, OsERF062, OsERF62, AP2/EREBP#125, AP2/EREBP125, AP2-125, OsLG3, LG3, OsLG3/OsAP2-125, OsAP2-125, WAP1, OsWAP1, OsSTAP1, STAP1, ERF1, OsERF1

Oryzabase Gene Name Synonym(s)

ethylene response factor 62, APETALA2/ethylene-responsive element binding protein 125, Wall-Associated regulator WAP1

Transcript Evidence

AK060527

Protein Evidence

Q10QU5

Literature

PMID: 28385155

Note

Manual Curation

January 9, 2018

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: transcription factor activity, sequence-specific DNA binding (GO:0003700)

Functional domain (InterPro)

AP2/ERF domain superfamily (IPR036955)

DNA-binding domain superfamily (IPR016177)

AP2/ERF domain (IPR001471)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

001-020-F02 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0183000-01)

RiceXPro (AK060527)

Others

Oryzabase (10576)

KEGG (Os03t0183000-01)

Transcript

1249 bp

>Os03t0183000-01 APETALA2/ethylene-responsive element binding protein 125, Transcription regulator, Positive regulator of grain length
ACAAAGGCATTCGCAACACACACTTGAAGAAAAAAAACACGACGAACACGTTAAAAAAAG
GTCGAAGAGAAGTGGGAGACCCAAACCGCGAACAATGTGTGGAGGCGCCATCCTCGCCGA
GTTCATcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccaccT
GTGGCCGGCCGGCTCCAAGAACGCCGCCCGCGGCAAGAGCAAGAGCAAGAGGCAGCAGAG
GAGCTTCGCCGACGTCGACGACTTCGAGGCCGCCTTCGAGCAGTTCGACGATGACTCCGA
CTTCGACGACGCGGAGGAAGAAGACGAAGGACACTTCGTGTTCGCGTCCAAATCTCGTGt
cgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcg
gcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgaccc
gcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgc
ctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccac
gcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggc
gacagcacccgccgccgccccgccgcgcggactgaagcgaGAATTCTCGCCGCCTGCTGA
GACCGCGCTACCTTTCTTCACCAACGGCTTCGTCGACCTGACGACCGCCGCGGCGCCGCC
ACCGGCCATGATGATGACGAGCTCCTTCACCGACAGCGTCGCCACGTCGGAGTCCGGCGG
GAGCCCCGCCAAGAAGGCGAGGTCCGACGACGTCGACTCGTCCGAGGGCAGCGTCGGCGG
CGGCAGCGACACGCTGGGTTTCACCGACGAGCTGGAGTTCGACCCGTTCATGCTGTTCCA
GCTCCCCTACTCCGACGGCTACGAGTCCATCGACAGCCTCTTCGCCGCCGGCGACGCCAA
CAGCGCGAACACCGACATGAACGCCGGCGTCAACCTGTGGAGCTTCGACGACTTCCCAAT
CGACGGCGCCCTTTTCTGATGTACTCCTCCATTGATGCAGTTTGTGCACTCAATTGTAAG
CATCTGAATTCACTTCCATTTTAATGGATTCAGTTAAAAACTTAAAATCCATCTGTTCAT
CAGGATTATATATCTTGATCAGATACCATGCCATTTCTTGGTTCAGGTT

CDS

1005 bp

>Os03t0183000-01 APETALA2/ethylene-responsive element binding protein 125, Transcription regulator, Positive regulator of grain length
ATGTGTGGAGGCGCCATCCTCGCCGAGTTCATcccggcgccgtcgcgcgccgcggcggcg
accaagcgggtgaccgccagccaccTGTGGCCGGCCGGCTCCAAGAACGCCGCCCGCGGC
AAGAGCAAGAGCAAGAGGCAGCAGAGGAGCTTCGCCGACGTCGACGACTTCGAGGCCGCC
TTCGAGCAGTTCGACGATGACTCCGACTTCGACGACGCGGAGGAAGAAGACGAAGGACAC
TTCGTGTTCGCGTCCAAATCTCGTGtcgtcgccgggcacgacgggcgcgcggcggcgagg
gcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatggggg
aagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttc
aacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagc
aaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacg
agagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactg
aagcgaGAATTCTCGCCGCCTGCTGAGACCGCGCTACCTTTCTTCACCAACGGCTTCGTC
GACCTGACGACCGCCGCGGCGCCGCCACCGGCCATGATGATGACGAGCTCCTTCACCGAC
AGCGTCGCCACGTCGGAGTCCGGCGGGAGCCCCGCCAAGAAGGCGAGGTCCGACGACGTC
GACTCGTCCGAGGGCAGCGTCGGCGGCGGCAGCGACACGCTGGGTTTCACCGACGAGCTG
GAGTTCGACCCGTTCATGCTGTTCCAGCTCCCCTACTCCGACGGCTACGAGTCCATCGAC
AGCCTCTTCGCCGCCGGCGACGCCAACAGCGCGAACACCGACATGAACGCCGGCGTCAAC
CTGTGGAGCTTCGACGACTTCCCAATCGACGGCGCCCTTTTCTGA

Protein

334 aa

>Os03t0183000-01 APETALA2/ethylene-responsive element binding protein 125, Transcription regulator, Positive regulator of grain length
MCGGAILAEFIPAPSRAAAATKRVTASHLWPAGSKNAARGKSKSKRQQRSFADVDDFEAA
FEQFDDDSDFDDAEEEDEGHFVFASKSRVVAGHDGRAAARAASKKKRGRHFRGIRQRPWG
KWAAEIRDPHKGTRVWLGTFNTPEEAARAYDVEARRLRGSKAKVNFPATPAAARPRRGNT
RATAVPPPATAPAAAPPRGLKREFSPPAETALPFFTNGFVDLTTAAAPPPAMMMTSSFTD
SVATSESGGSPAKKARSDDVDSSEGSVGGGSDTLGFTDELEFDPFMLFQLPYSDGYESID
SLFAAGDANSANTDMNAGVNLWSFDDFPIDGALF*

5'UTR

chr03:4350438..4350531 (- strand) : 94 bp

CDS

chr03:4350173..4350437 (- strand) : 265 bp

chr03:4349324..4350063 (- strand) : 740 bp

3'UTR

chr03:4349174..4349323 (- strand) : 150 bp

FASTA

>Os03t0183000-01 class=Sequence position=chr03:4349174..4350531 (- strand)
ACAAAGGCAT TCGCAACACA CACTTGAAGA AAAAAAACAC GACGAACACG TTAAAAAAAG GTCGAAGAGA AGTGGGAGAC
CCAAACCGCG AACAATGTGT GGAGGCGCCA TCCTCGCCGA GTTCATcccg gcgccgtcgc gcgccgcggc ggcgaccaag
cgggtgaccg ccagccaccT GTGGCCGGCC GGCTCCAAGA ACGCCGCCCG CGGCAAGAGC AAGAGCAAGA GGCAGCAGAG
GAGCTTCGCC GACGTCGACG ACTTCGAGGC CGCCTTCGAG CAGTTCGACG ATGACTCCGA CTTCGACGAC GCGGAGGAAG
AAGACGAAGG ACACTTCGTG TTCGCGTCCA AATCTCGTGG TAATGTTCGT CGCGTGCGAT CTCGTCTAGG TGTTCGATCG
TGATGGCGAT GAGTTCTTGG CTTGATCTCA CCGAGGAAGA TTGGTTTGGT TTGGTTTTGT TCGTgcagtc gtcgccgggc
acgacgggcg cgcggcggcg agggcggcga gcaagaagaa gcgggggcgg cacttccgag gcatccggca gcggccatgg
gggaagtggg cggcggagat ccgcgacccg cacaagggca cgcgcgtctg gctcggcacg ttcaacaccc cggaggaggc
cgcacgcgcc tacgacgtcg aggcgcgccg cctccgcggc agcaaggcca aggtcaactt ccccgccacg cccgccgccg
cgcgcccacg ccgcggcaac acgagagcca ccgccgtgcc accgccggcg acagcacccg ccgccgcccc gccgcgcgga
ctgaagcgaG AATTCTCGCC GCCTGCTGAG ACCGCGCTAC CTTTCTTCAC CAACGGCTTC GTCGACCTGA CGACCGCCGC
GGCGCCGCCA CCGGCCATGA TGATGACGAG CTCCTTCACC GACAGCGTCG CCACGTCGGA GTCCGGCGGG AGCCCCGCCA
AGAAGGCGAG GTCCGACGAC GTCGACTCGT CCGAGGGCAG CGTCGGCGGC GGCAGCGACA CGCTGGGTTT CACCGACGAG
CTGGAGTTCG ACCCGTTCAT GCTGTTCCAG CTCCCCTACT CCGACGGCTA CGAGTCCATC GACAGCCTCT TCGCCGCCGG
CGACGCCAAC AGCGCGAACA CCGACATGAA CGCCGGCGTC AACCTGTGGA GCTTCGACGA CTTCCCAATC GACGGCGCCC
TTTTCTGATG TACTCCTCCA TTGATGCAGT TTGTGCACTC AATTGTAAGC ATCTGAATTC ACTTCCATTT TAATGGATTC
AGTTAAAAAC TTAAAATCCA TCTGTTCATC AGGATTATAT ATCTTGATCA GATACCATGC CATTTCTTGG TTCAGGTT

Locus: Os03g0183000

Loading...

Locus: Os03g0183000

Loading...