Os03t0183000-02

Locus

Os03g0183000

Description

Similar to AP2 domain containing protein RAP2.6 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ERF62

CGSNL Gene Name

ETHYLENE RESPONSE FACTOR 62

Oryzabase Gene Symbol Synonym(s)

OsERF#062, OsERF062, OsERF62, AP2/EREBP#125, AP2/EREBP125, AP2-125, OsLG3, LG3, OsLG3/OsAP2-125, OsAP2-125, WAP1, OsWAP1, OsSTAP1, STAP1, ERF1, OsERF1

Oryzabase Gene Name Synonym(s)

ethylene response factor 62, APETALA2/ethylene-responsive element binding protein 125, Wall-Associated regulator WAP1

Transcript Evidence

AK101949 (DDBJ, Best hit)

Protein Evidence

Q94HF3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Functional domain (InterPro)

Pathogenesis-related transcriptional factor/ERF, DNA-binding (IPR001471)

DNA-binding, integrase-type (IPR016177)

Full-length cDNA

J033075D23 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0183000-02)

RiceXPro (AK101949)

Others

Oryzabase (10576)

KEGG (Os03t0183000-02)

Transcript

1574 bp

>Os03t0183000-02 Similar to AP2 domain containing protein RAP2.6 (Fragment).
AAAGGCATTCGCAACACACACTTGAAGAAAAAAAACACGACGAACACGTTAAAAAAAGGT
CGAAGAGAAGTGGGAGACCCAAACCGCGAACAATGTGTGGAGGCGCCATCCTCGCCGAGT
TCATcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccaccTGT
GGCCGGCCGGCTCCAAGAACGCCGCCCGCGGCAAGAGCAAGAGCAAGAGGCAGCAGAGGA
GCTTCGCCGACGTCGACGACTTCGAGGCCGCCTTCGAGCAGTTCGACGATGACTCCGACT
TCGACGACGCGGAGGAAGAAGACGAAGGACACTTCGTGTTCGCGTCCAAATCTCGTGtcg
tcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggc
acttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgc
acaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcct
acgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgc
ccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcga
cagcacccgccgccgccccgccgcgcggactgaagcgaGAATTCTCGCCGCCTGCTGAGA
CCGCGCTACCTTTCTTCACCAACGGCTTCGTCGACCTGACGACCGCCGCGGCGCCGCCAC
CGGCCATGATGATGACGAGCTCCTTCACCGACAGCGTCGCCACGTCGGAGTCCGGCGGGA
GCCCCGCCAAGAAGGCGAGGTCCGACGACGTCGACTCGTCCGAGGGCAGCGTCGGCGGCG
GCAGCGACACGCTGGGTTTCACCGACGAGCTGGAGTTCGACCCGTTCATGCTGTTCCAGC
TCCCCTACTCCGACGGCTACGAGTCCATCGACAGCCTCTTCGCCGCCGGCGACGCCAACA
GCGCGAACACCGACATGAACGCCGGCGTCAACCTGTGGAGCTTCGACGACTTCCCAATCG
ACGGCGCCCTTTTCTGATGTACTCCTCCATTGATGCAGTTTGTGCACTCAATTGTTAATC
ACGTCGTCGTTGATGAATGTTTAACCGGAGGATGATGGGGTGCAGCTGATATCATGGCTT
GCTTGATTACCGAATTATATTGCGGTGTTTGTGTTTGTCAATTAGATTCTGAATCTGTAC
TACTGCCGATCTTATGATCAAAACTATATATTAAGTTTATGTACTCTTAATTTGTGGGCT
ACTTTTACGGGGTCTTCGTACTGCTGGTCAAATAGTCCTATGAAATCGATCATGTCGGCA
ATATCGTCGTCAATTATCGTGGTCGTGGTTGTTAATGATGTCAAATAAGTCTATGAAAAC
CTGGTCCTCTTGGTGTTTATGTACCACTGATCGATCCATCATTTGATCTCTGTCATGTTG
AGATGGATCGTGTAAGAATATCATAATTTGCTGGATTCAGTCCAGTCGTAATGTATTTTG
GTTTGTACAACTGC

CDS

1005 bp

>Os03t0183000-02 Similar to AP2 domain containing protein RAP2.6 (Fragment).
ATGTGTGGAGGCGCCATCCTCGCCGAGTTCATcccggcgccgtcgcgcgccgcggcggcg
accaagcgggtgaccgccagccaccTGTGGCCGGCCGGCTCCAAGAACGCCGCCCGCGGC
AAGAGCAAGAGCAAGAGGCAGCAGAGGAGCTTCGCCGACGTCGACGACTTCGAGGCCGCC
TTCGAGCAGTTCGACGATGACTCCGACTTCGACGACGCGGAGGAAGAAGACGAAGGACAC
TTCGTGTTCGCGTCCAAATCTCGTGtcgtcgccgggcacgacgggcgcgcggcggcgagg
gcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatggggg
aagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttc
aacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagc
aaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacg
agagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactg
aagcgaGAATTCTCGCCGCCTGCTGAGACCGCGCTACCTTTCTTCACCAACGGCTTCGTC
GACCTGACGACCGCCGCGGCGCCGCCACCGGCCATGATGATGACGAGCTCCTTCACCGAC
AGCGTCGCCACGTCGGAGTCCGGCGGGAGCCCCGCCAAGAAGGCGAGGTCCGACGACGTC
GACTCGTCCGAGGGCAGCGTCGGCGGCGGCAGCGACACGCTGGGTTTCACCGACGAGCTG
GAGTTCGACCCGTTCATGCTGTTCCAGCTCCCCTACTCCGACGGCTACGAGTCCATCGAC
AGCCTCTTCGCCGCCGGCGACGCCAACAGCGCGAACACCGACATGAACGCCGGCGTCAAC
CTGTGGAGCTTCGACGACTTCCCAATCGACGGCGCCCTTTTCTGA

Protein

334 aa

>Os03t0183000-02 Similar to AP2 domain containing protein RAP2.6 (Fragment).
MCGGAILAEFIPAPSRAAAATKRVTASHLWPAGSKNAARGKSKSKRQQRSFADVDDFEAA
FEQFDDDSDFDDAEEEDEGHFVFASKSRVVAGHDGRAAARAASKKKRGRHFRGIRQRPWG
KWAAEIRDPHKGTRVWLGTFNTPEEAARAYDVEARRLRGSKAKVNFPATPAAARPRRGNT
RATAVPPPATAPAAAPPRGLKREFSPPAETALPFFTNGFVDLTTAAAPPPAMMMTSSFTD
SVATSESGGSPAKKARSDDVDSSEGSVGGGSDTLGFTDELEFDPFMLFQLPYSDGYESID
SLFAAGDANSANTDMNAGVNLWSFDDFPIDGALF*

5'UTR

chr03:4350438..4350529 (- strand) : 92 bp

CDS

chr03:4350173..4350437 (- strand) : 265 bp

chr03:4349324..4350063 (- strand) : 740 bp

3'UTR

chr03:4349288..4349323 (- strand) : 36 bp

chr03:4348736..4349176 (- strand) : 441 bp

FASTA

>Os03t0183000-02 class=Sequence position=chr03:4348736..4350529 (- strand)
AAAGGCATTC GCAACACACA CTTGAAGAAA AAAAACACGA CGAACACGTT AAAAAAAGGT CGAAGAGAAG TGGGAGACCC
AAACCGCGAA CAATGTGTGG AGGCGCCATC CTCGCCGAGT TCATcccggc gccgtcgcgc gccgcggcgg cgaccaagcg
ggtgaccgcc agccaccTGT GGCCGGCCGG CTCCAAGAAC GCCGCCCGCG GCAAGAGCAA GAGCAAGAGG CAGCAGAGGA
GCTTCGCCGA CGTCGACGAC TTCGAGGCCG CCTTCGAGCA GTTCGACGAT GACTCCGACT TCGACGACGC GGAGGAAGAA
GACGAAGGAC ACTTCGTGTT CGCGTCCAAA TCTCGTGGTA ATGTTCGTCG CGTGCGATCT CGTCTAGGTG TTCGATCGTG
ATGGCGATGA GTTCTTGGCT TGATCTCACC GAGGAAGATT GGTTTGGTTT GGTTTTGTTC GTgcagtcgt cgccgggcac
gacgggcgcg cggcggcgag ggcggcgagc aagaagaagc gggggcggca cttccgaggc atccggcagc ggccatgggg
gaagtgggcg gcggagatcc gcgacccgca caagggcacg cgcgtctggc tcggcacgtt caacaccccg gaggaggccg
cacgcgccta cgacgtcgag gcgcgccgcc tccgcggcag caaggccaag gtcaacttcc ccgccacgcc cgccgccgcg
cgcccacgcc gcggcaacac gagagccacc gccgtgccac cgccggcgac agcacccgcc gccgccccgc cgcgcggact
gaagcgaGAA TTCTCGCCGC CTGCTGAGAC CGCGCTACCT TTCTTCACCA ACGGCTTCGT CGACCTGACG ACCGCCGCGG
CGCCGCCACC GGCCATGATG ATGACGAGCT CCTTCACCGA CAGCGTCGCC ACGTCGGAGT CCGGCGGGAG CCCCGCCAAG
AAGGCGAGGT CCGACGACGT CGACTCGTCC GAGGGCAGCG TCGGCGGCGG CAGCGACACG CTGGGTTTCA CCGACGAGCT
GGAGTTCGAC CCGTTCATGC TGTTCCAGCT CCCCTACTCC GACGGCTACG AGTCCATCGA CAGCCTCTTC GCCGCCGGCG
ACGCCAACAG CGCGAACACC GACATGAACG CCGGCGTCAA CCTGTGGAGC TTCGACGACT TCCCAATCGA CGGCGCCCTT
TTCTGATGTA CTCCTCCATT GATGCAGTTT GTGCACTCAA TTGTAAGCAT CTGAATTCAC TTCCATTTTA ATGGATTCAG
TTAAAAACTT AAAATCCATC TGTTCATCAG GATTATATAT CTTGATCAGA TACCATGCCA TTTCTTGGTT CAGGTTAATC
ACGTCGTCGT TGATGAATGT TTAACCGGAG GATGATGGGG TGCAGCTGAT ATCATGGCTT GCTTGATTAC CGAATTATAT
TGCGGTGTTT GTGTTTGTCA ATTAGATTCT GAATCTGTAC TACTGCCGAT CTTATGATCA AAACTATATA TTAAGTTTAT
GTACTCTTAA TTTGTGGGCT ACTTTTACGG GGTCTTCGTA CTGCTGGTCA AATAGTCCTA TGAAATCGAT CATGTCGGCA
ATATCGTCGT CAATTATCGT GGTCGTGGTT GTTAATGATG TCAAATAAGT CTATGAAAAC CTGGTCCTCT TGGTGTTTAT
GTACCACTGA TCGATCCATC ATTTGATCTC TGTCATGTTG AGATGGATCG TGTAAGAATA TCATAATTTG CTGGATTCAG
TCCAGTCGTA ATGTATTTTG GTTTGTACAA CTGC

Locus: Os03g0183000

Loading...

Locus: Os03g0183000

Loading...