Os03t0183300-01

Locus

Os03g0183300

Description

Pathogenesis-related transcriptional factor and ERF domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ERF64

CGSNL Gene Name

ETHYLENE RESPONSE FACTOR 64

Oryzabase Gene Symbol Synonym(s)

OsERF#064, OsERF064, OsERF64, AP2/EREBP#029, AP2/EREBP29, OsBIERF4, BIERF4

Oryzabase Gene Name Synonym(s)

ethylene response factor 64, APETALA2/ethylene-responsive element binding protein 29, benzothiadiazole (BTH)-induced ethylene responsive transcriptional factor 4, benzothiadiazole-induced ethylene responsive transcriptional factor 4, BTH-induced ethylene responsive transcriptional factor 4, BTH-induced ERF transcriptional factor 4

Transcript Evidence

AK106163 (DDBJ, Best hit)

AK105922 (DDBJ, Best hit)

AK119553 (DDBJ, Best hit)

Protein Evidence

Q5MFV0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Functional domain (InterPro)

Pathogenesis-related transcriptional factor/ERF, DNA-binding (IPR001471)

DNA-binding, integrase-type (IPR016177)

Full-length cDNA

001-208-B04 (Online Clone Ordering)

001-205-A05 (Online Clone Ordering)

001-208-C04 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0183300-01)

RiceXPro (AK106163)

Others

Oryzabase (10577)

KEGG (Os03t0183300-01)

Transcript

1192 bp

>Os03t0183300-01 Pathogenesis-related transcriptional factor and ERF domain containing protein.
TCATCACAAGCTCACAAGTTCACAACCCAACACCCAAAAGCAAAAGAAAAGCAGCAACCA
AAGATGTGCGGCGGAGCGATCCTTGCGGAGCTCATACCGAGCGCGCCGGCGGCGAGGCGC
GTCACGGCGGGCCACGTCTGGCCGGGCGACGCCAACAAGGCCAAGAAGAAGGGCGCGCGC
GCCGACGACTTCGAGGCCGCGTTCCGCGACTTCGACAACGACTCCGATGACGAGGAGATG
ATGGTGGAGGAGGCGGAGGAGGAGGAGGCGACCTCCGAGCACAAGCCGTTCGTCTTccgc
gccaagaaggcggcggcggcggcgtcgagcaggcgcaggaagccggcgcagtacaggggc
gtgcggcgccggccgtgggggaagtgggcggcggagatccgcgaccccgtcaagggcatc
cgcgtctggctcggcaccttcaccaacgccgaggccgccgcgctcgcctacgacgacgcc
gcgcgcgccatccgcggggacagggccaagctcaacttcccttccgctaccacccctgac
acccgcaagcgcggccgcgccaccgccgccgccgccCCGGCCGTCAAGGCGACCCCGGTC
ATCAACCTCGTCGAGGAGGAGGACGAGGAGGAGGTCGCCGCCGCCATGGCGTCCATCAAG
TACGAGCCCGAGACCAGCGAGAGCTCCGAGTCGAACGCCCTCCCGGACTTCTCCTGGCAG
GGCATGTCGGCCTCCGACGAGTTCGCCGTCGCCGCGGCGGCGCTGTCGCTCGACAGCGAC
GACGACCTCGCCAAGAAGCGTCCGAGGACCGAGCCGGAGGACACCACCGACTCCGGCTCC
GGCGACGACACCGACGCGCTGTTCGACGCGCTGCTGTTCGCCGACCAGTACAACCACTTC
AACGGCGGCGCCTACGAGTCCCTGGACAGCCTGTTCAGCGCCGACGCCGTGCAGACCACC
GCCGCCGCCGCCGCCGCCGACCAGGGCATGGGGCTCTGGAGCTTCGACGACGGCTGCTGC
CTCGTCGACGTCGAGGCCAGCTTGTCCTTCTAGGCTCTAGCCGTCGTCTCCGGCGACCCT
GTGACTCGATCTTGTACCATGTCATGTACATAGAAGAGTGGTTTTGCCAAGCAAGCATGT
GTTCGTCCTGGTTCCTTTCGGTAATGAAAAATTATGTGAGGCTTCTCGTTCT

CDS

990 bp

>Os03t0183300-01 Pathogenesis-related transcriptional factor and ERF domain containing protein.
ATGTGCGGCGGAGCGATCCTTGCGGAGCTCATACCGAGCGCGCCGGCGGCGAGGCGCGTC
ACGGCGGGCCACGTCTGGCCGGGCGACGCCAACAAGGCCAAGAAGAAGGGCGCGCGCGCC
GACGACTTCGAGGCCGCGTTCCGCGACTTCGACAACGACTCCGATGACGAGGAGATGATG
GTGGAGGAGGCGGAGGAGGAGGAGGCGACCTCCGAGCACAAGCCGTTCGTCTTccgcgcc
aagaaggcggcggcggcggcgtcgagcaggcgcaggaagccggcgcagtacaggggcgtg
cggcgccggccgtgggggaagtgggcggcggagatccgcgaccccgtcaagggcatccgc
gtctggctcggcaccttcaccaacgccgaggccgccgcgctcgcctacgacgacgccgcg
cgcgccatccgcggggacagggccaagctcaacttcccttccgctaccacccctgacacc
cgcaagcgcggccgcgccaccgccgccgccgccCCGGCCGTCAAGGCGACCCCGGTCATC
AACCTCGTCGAGGAGGAGGACGAGGAGGAGGTCGCCGCCGCCATGGCGTCCATCAAGTAC
GAGCCCGAGACCAGCGAGAGCTCCGAGTCGAACGCCCTCCCGGACTTCTCCTGGCAGGGC
ATGTCGGCCTCCGACGAGTTCGCCGTCGCCGCGGCGGCGCTGTCGCTCGACAGCGACGAC
GACCTCGCCAAGAAGCGTCCGAGGACCGAGCCGGAGGACACCACCGACTCCGGCTCCGGC
GACGACACCGACGCGCTGTTCGACGCGCTGCTGTTCGCCGACCAGTACAACCACTTCAAC
GGCGGCGCCTACGAGTCCCTGGACAGCCTGTTCAGCGCCGACGCCGTGCAGACCACCGCC
GCCGCCGCCGCCGCCGACCAGGGCATGGGGCTCTGGAGCTTCGACGACGGCTGCTGCCTC
GTCGACGTCGAGGCCAGCTTGTCCTTCTAG

Protein

330 aa

>Os03t0183300-01 Pathogenesis-related transcriptional factor and ERF domain containing protein.
MCGGAILAELIPSAPAARRVTAGHVWPGDANKAKKKGARADDFEAAFRDFDNDSDDEEMM
VEEAEEEEATSEHKPFVFRAKKAAAAASSRRRKPAQYRGVRRRPWGKWAAEIRDPVKGIR
VWLGTFTNAEAAALAYDDAARAIRGDRAKLNFPSATTPDTRKRGRATAAAAPAVKATPVI
NLVEEEDEEEVAAAMASIKYEPETSESSESNALPDFSWQGMSASDEFAVAAAALSLDSDD
DLAKKRPRTEPEDTTDSGSGDDTDALFDALLFADQYNHFNGGAYESLDSLFSADAVQTTA
AAAAADQGMGLWSFDDGCCLVDVEASLSF*

5'UTR

chr03:4373398..4373460 (- strand) : 63 bp

CDS

chr03:4372408..4373397 (- strand) : 990 bp

3'UTR

chr03:4372269..4372407 (- strand) : 139 bp

FASTA

>Os03t0183300-01 class=Sequence position=chr03:4372269..4373460 (- strand)
TCATCACAAG CTCACAAGTT CACAACCCAA CACCCAAAAG CAAAAGAAAA GCAGCAACCA AAGATGTGCG GCGGAGCGAT
CCTTGCGGAG CTCATACCGA GCGCGCCGGC GGCGAGGCGC GTCACGGCGG GCCACGTCTG GCCGGGCGAC GCCAACAAGG
CCAAGAAGAA GGGCGCGCGC GCCGACGACT TCGAGGCCGC GTTCCGCGAC TTCGACAACG ACTCCGATGA CGAGGAGATG
ATGGTGGAGG AGGCGGAGGA GGAGGAGGCG ACCTCCGAGC ACAAGCCGTT CGTCTTccgc gccaagaagg cggcggcggc
ggcgtcgagc aggcgcagga agccggcgca gtacaggggc gtgcggcgcc ggccgtgggg gaagtgggcg gcggagatcc
gcgaccccgt caagggcatc cgcgtctggc tcggcacctt caccaacgcc gaggccgccg cgctcgccta cgacgacgcc
gcgcgcgcca tccgcgggga cagggccaag ctcaacttcc cttccgctac cacccctgac acccgcaagc gcggccgcgc
caccgccgcc gccgccCCGG CCGTCAAGGC GACCCCGGTC ATCAACCTCG TCGAGGAGGA GGACGAGGAG GAGGTCGCCG
CCGCCATGGC GTCCATCAAG TACGAGCCCG AGACCAGCGA GAGCTCCGAG TCGAACGCCC TCCCGGACTT CTCCTGGCAG
GGCATGTCGG CCTCCGACGA GTTCGCCGTC GCCGCGGCGG CGCTGTCGCT CGACAGCGAC GACGACCTCG CCAAGAAGCG
TCCGAGGACC GAGCCGGAGG ACACCACCGA CTCCGGCTCC GGCGACGACA CCGACGCGCT GTTCGACGCG CTGCTGTTCG
CCGACCAGTA CAACCACTTC AACGGCGGCG CCTACGAGTC CCTGGACAGC CTGTTCAGCG CCGACGCCGT GCAGACCACC
GCCGCCGCCG CCGCCGCCGA CCAGGGCATG GGGCTCTGGA GCTTCGACGA CGGCTGCTGC CTCGTCGACG TCGAGGCCAG
CTTGTCCTTC TAGGCTCTAG CCGTCGTCTC CGGCGACCCT GTGACTCGAT CTTGTACCAT GTCATGTACA TAGAAGAGTG
GTTTTGCCAA GCAAGCATGT GTTCGTCCTG GTTCCTTTCG GTAATGAAAA ATTATGTGAG GCTTCTCGTT CT

Locus: Os03g0183300

Loading...

Locus: Os03g0183300

Loading...