Os03t0183300-02

Locus

Os03g0183300

Description

Similar to BTH-induced ERF transcriptional factor 4.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ERF64

CGSNL Gene Name

ETHYLENE RESPONSE FACTOR 64

Oryzabase Gene Symbol Synonym(s)

OsERF#064, OsERF064, OsERF64, AP2/EREBP#029, AP2/EREBP29, OsBIERF4, BIERF4

Oryzabase Gene Name Synonym(s)

ethylene response factor 64, APETALA2/ethylene-responsive element binding protein 29, benzothiadiazole (BTH)-induced ethylene responsive transcriptional factor 4, benzothiadiazole-induced ethylene responsive transcriptional factor 4, BTH-induced ethylene responsive transcriptional factor 4, BTH-induced ERF transcriptional factor 4

Transcript Evidence

AK058349 (DDBJ, Best hit)

Protein Evidence

Q5MFV0 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-014-E05 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0183300-02)

Others

Oryzabase (10577)

Transcript

525 bp

>Os03t0183300-02 Similar to BTH-induced ERF transcriptional factor 4.
ATCACAAGCTCACAAGTTCACAACCCAACACCCAAAAGCAAAAGAAAAGCAGCAACCAAA
GATGTGCGGCGGAGCGATCCTTGCGGAGCTCATACCGAGCGCGCCGGCGGCGAGGCGCGT
CACGGCGGGCCACGTCTGGCCGGGCGACGCCAACAAGGCCAAGAAGAAGGGCGCGCGCGC
CGACGACTTCGAGGCCGCGTTCCGCGACTTCGACAACGACTCCGATGACGAGGAGATGAT
GGTGGAGGAGGCGGAGGAGGAGGAGGCGACCTCCGAGCACAAGCCGTTCGTCTTccgcCG
CCGCCGCCGACCAGGGCATGGGGCTCTGGAGCTTCGACGACGGCTGCTGCCTCGTCGACG
TCGAGGCCAGCTTGTCCTTCTAGGCTCTAGCCGTCGTCTCCGGCGACCCTGTGACTCGAT
CTTGTACCATGTCATGTACATAGAAGAGTGGTTTTGCCAAGCAAGCATGTGTTCGTCCTG
GTTCCTTTCGGTAATGAAAAATTATGTGAGGCTTCTCGTTCTCGT

CDS

464 bp

>Os03t0183300-02 Similar to BTH-induced ERF transcriptional factor 4.
ATGTGCGGCGGAGCGATCCTTGCGGAGCTCATACCGAGCGCGCCGGCGGCGAGGCGCGTC
ACGGCGGGCCACGTCTGGCCGGGCGACGCCAACAAGGCCAAGAAGAAGGGCGCGCGCGCC
GACGACTTCGAGGCCGCGTTCCGCGACTTCGACAACGACTCCGATGACGAGGAGATGATG
GTGGAGGAGGCGGAGGAGGAGGAGGCGACCTCCGAGCACAAGCCGTTCGTCTTccgcCGC
CGCCGCCGACCAGGGCATGGGGCTCTGGAGCTTCGACGACGGCTGCTGCCTCGTCGACGT
CGAGGCCAGCTTGTCCTTCTAGGCTCTAGCCGTCGTCTCCGGCGACCCTGTGACTCGATC
TTGTACCATGTCATGTACATAGAAGAGTGGTTTTGCCAAGCAAGCATGTGTTCGTCCTGG
TTCCTTTCGGTAATGAAAAATTATGTGAGGCTTCTCGTTCTCGT

Protein

154 aa

>Os03t0183300-02 Similar to BTH-induced ERF transcriptional factor 4.
MCGGAILAELIPSAPAARRVTAGHVWPGDANKAKKKGARADDFEAAFRDFDNDSDDEEMM
VEEAEEEEATSEHKPFVFRRRRRPGHGALELRRRLLPRRRRGQLVLLGSSRRLRRPCDSI
LYHVMYIEEWFCQASMCSSWFLSVMKNYVRLLVL

5'UTR

chr03:4373398..4373458 (- strand) : 61 bp

CDS

chr03:4373161..4373397 (- strand) : 237 bp

chr03:4372266..4372492 (- strand) : 227 bp

FASTA

>Os03t0183300-02 class=Sequence position=chr03:4372266..4373458 (- strand)
ATCACAAGCT CACAAGTTCA CAACCCAACA CCCAAAAGCA AAAGAAAAGC AGCAACCAAA GATGTGCGGC GGAGCGATCC
TTGCGGAGCT CATACCGAGC GCGCCGGCGG CGAGGCGCGT CACGGCGGGC CACGTCTGGC CGGGCGACGC CAACAAGGCC
AAGAAGAAGG GCGCGCGCGC CGACGACTTC GAGGCCGCGT TCCGCGACTT CGACAACGAC TCCGATGACG AGGAGATGAT
GGTGGAGGAG GCGGAGGAGG AGGAGGCGAC CTCCGAGCAC AAGCCGTTCG TCTTccgcgc caagaaggcg gcggcggcgg
cgtcgagcag gcgcaggaag ccggcgcagt acaggggcgt gcggcgccgg ccgtggggga agtgggcggc ggagatccgc
gaccccgtca agggcatccg cgtctggctc ggcaccttca ccaacgccga ggccgccgcg ctcgcctacg acgacgccgc
gcgcgccatc cgcggggaca gggccaagct caacttccct tccgctacca cccctgacac ccgcaagcgc ggccgcgcca
ccgccgccgc cgccCCGGCC GTCAAGGCGA CCCCGGTCAT CAACCTCGTC GAGGAGGAGG ACGAGGAGGA GGTCGCCGCC
GCCATGGCGT CCATCAAGTA CGAGCCCGAG ACCAGCGAGA GCTCCGAGTC GAACGCCCTC CCGGACTTCT CCTGGCAGGG
CATGTCGGCC TCCGACGAGT TCGCCGTCGC CGCGGCGGCG CTGTCGCTCG ACAGCGACGA CGACCTCGCC AAGAAGCGTC
CGAGGACCGA GCCGGAGGAC ACCACCGACT CCGGCTCCGG CGACGACACC GACGCGCTGT TCGACGCGCT GCTGTTCGCC
GACCAGTACA ACCACTTCAA CGGCGGCGCC TACGAGTCCC TGGACAGCCT GTTCAGCGCC GACGCCGTGC AGACCACCGC
CGCCGCCGCC GCCGCCGACC AGGGCATGGG GCTCTGGAGC TTCGACGACG GCTGCTGCCT CGTCGACGTC GAGGCCAGCT
TGTCCTTCTA GGCTCTAGCC GTCGTCTCCG GCGACCCTGT GACTCGATCT TGTACCATGT CATGTACATA GAAGAGTGGT
TTTGCCAAGC AAGCATGTGT TCGTCCTGGT TCCTTTCGGT AATGAAAAAT TATGTGAGGC TTCTCGTTCT CGT

Locus: Os03g0183300

Loading...

Locus: Os03g0183300

Loading...