Os03t0186600-01

Locus

Os03g0186600

Description

MADS-box transcription factor, Negative regulation of brassinosteroid (BR)-mediated lamina joint inclination, BR-mediated coleoptile elongation

RAP-DB Gene Symbol Synonym(s)

OsMDP1, OsMADS47

RAP-DB Gene Name Synonym(s)

MADS domain protein 1, MADS box gene 47

CGSNL Gene Symbol

MADS47

CGSNL Gene Name

MADS BOX GENE 47

Oryzabase Gene Symbol Synonym(s)

OsMADS47, OsMDP1, MDP, MDP1

Oryzabase Gene Name Synonym(s)

MADS box gene47, MADS-domain-contaiing protein1, MADS-domain-containing protein 1, MADS-box transcription factor 47, MADS-DOMAIN-CONTAIING PROTEIN1, MADS domain protein 1

Transcript Evidence

AK242211

Protein Evidence

Q5K4R0-2

Literature

PMID: 16827922

Note

Manual Curation

January 28, 2021

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Biological Process: positive regulation of transcription by RNA polymerase II (GO:0045944)

Molecular Function: RNA polymerase II regulatory region sequence-specific DNA binding (GO:0000977)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: DNA-binding transcription factor activity (GO:0003700)

Molecular Function: protein dimerization activity (GO:0046983)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Transcription factor, MADS-box superfamily (IPR036879)

Transcription factor, MADS-box (IPR002100)

MADS MEF2-like (IPR033896)

Transcription factor, K-box (IPR002487)

Full-length cDNA

J075171C16 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0186600-01)

Others

Oryzabase (3102)

KEGG (Os03t0186600-01)

Transcript

1368 bp

>Os03t0186600-01 MADS-box transcription factor, Negative regulation of brassinosteroid (BR)-mediated lamina joint inclination, BR-mediated coleoptile elongation
ATTGGTGGTGGTCTCCATTGCTCCCTTCCTCCCTGCCTTTTTCTTCCATAAGTAGTAGTA
GTAGCGGGAGTGGCCGCCGCCGCAGCCATAGATCTGCGGCGCCGCGTATCTCGCGGCTGG
TTTGGCTGGTGCGGTTAGCGGCTAGGGTTTTGGTTGTTTCGTCTGATCGATCCTCCCCGA
TTTTGCGGCGGCGGTGGTGAATTGGTGTGTGATCTGATATGGCTGGCGGCGGCGGTGGCG
GGGGAAGGGGGGAGGGGGAGGGGAGGGCGGCGACGGGGAAGAGGGAGAGGATAGCAATAC
GGAGGATCGACAACCTGGCGGCGAGGCAGGTGACCTTCTCGAAGCGGAGGAGGGGGCTGT
TCAAGAAGGCCGAGGAGCTCTCCATCCTCTGCGACGCCGAGGTCGGGCTCGTCGTCTTCT
CCGCCACCGGCAAGCTCTTCCAATTCGCCAGCACCAGCATGGAACAGATTATTGACCGGT
ACAACTCGCATTCCAAGACACTTCAGAGAGCAGAACCTTCTCAACTCGACTTACAAGGGG
AGGACAGCAGTACTTGTGCCAGACTAAAGGAGGAGCTTGCAGAAACTAGCCTTAGGCTGA
GGCAGATGAGAGGAGAGGAGCTGCACAGGCTGAATGTGGAACAGCTGCAGGAGCTAGAGA
AGAGCCTCGAGTCCGGTCTAGGCTCTGTTCTCAAGACCAAGAGCAAGAAAATTCTGGATG
AGATCGATGGACTGGAACGAAAGAGGATGCAATTGATAGAGGAGAATTTAAGGCTGAAGG
AGCAAGTGTCCAGGATGTCAAGAATGGAGGAGATGCAGCCTGGGCCTGATTCAGAAATCG
TGTACGAGGAAGGGCAGTCGTCTGAATCTGTCACCAATGCTTCTTACCCGCGACCTCCAC
CCGACAACGACTACAGCTCTGATACATCTCTCAGGCTCGGGTTGTCACTCTTCAGCTCCA
AGTGATGGCTGGAAACTAAAACTGAGAGGAAACAGCTGGATGGCATGCCTGCATCGCCAA
ATGATCAGTGCATGCACTGCAAGACTGCAACAAATAACACAGTTTTAGATTGCCAGATGA
TGATGTGTGTGTGCTGAGAGTCACTGGCTATTATCGTACACATAATAACAATAGAACGAA
CAAGTTCTTCTGTTCTTGGATGTTACCTGAATTCTACTCCCATACATGTTGTCAATGGCT
CTGTAATCGAGTGTCTGCAATTCCAGCTGAAAGCAACCGATTACAGGGAAATAAGCTATT
TTTTCTTAAAGTTCTAGCTAGCTTGGTACAGTTCATAAGCCGTAGAAAAACAAAGGCAAA
TAGGACAATATatcaaaagtcatttttaggtaaagcttttatatctcc

CDS

747 bp

>Os03t0186600-01 MADS-box transcription factor, Negative regulation of brassinosteroid (BR)-mediated lamina joint inclination, BR-mediated coleoptile elongation
ATGGCTGGCGGCGGCGGTGGCGGGGGAAGGGGGGAGGGGGAGGGGAGGGCGGCGACGGGG
AAGAGGGAGAGGATAGCAATACGGAGGATCGACAACCTGGCGGCGAGGCAGGTGACCTTC
TCGAAGCGGAGGAGGGGGCTGTTCAAGAAGGCCGAGGAGCTCTCCATCCTCTGCGACGCC
GAGGTCGGGCTCGTCGTCTTCTCCGCCACCGGCAAGCTCTTCCAATTCGCCAGCACCAGC
ATGGAACAGATTATTGACCGGTACAACTCGCATTCCAAGACACTTCAGAGAGCAGAACCT
TCTCAACTCGACTTACAAGGGGAGGACAGCAGTACTTGTGCCAGACTAAAGGAGGAGCTT
GCAGAAACTAGCCTTAGGCTGAGGCAGATGAGAGGAGAGGAGCTGCACAGGCTGAATGTG
GAACAGCTGCAGGAGCTAGAGAAGAGCCTCGAGTCCGGTCTAGGCTCTGTTCTCAAGACC
AAGAGCAAGAAAATTCTGGATGAGATCGATGGACTGGAACGAAAGAGGATGCAATTGATA
GAGGAGAATTTAAGGCTGAAGGAGCAAGTGTCCAGGATGTCAAGAATGGAGGAGATGCAG
CCTGGGCCTGATTCAGAAATCGTGTACGAGGAAGGGCAGTCGTCTGAATCTGTCACCAAT
GCTTCTTACCCGCGACCTCCACCCGACAACGACTACAGCTCTGATACATCTCTCAGGCTC
GGGTTGTCACTCTTCAGCTCCAAGTGA

Protein

248 aa

>Os03t0186600-01 MADS-box transcription factor, Negative regulation of brassinosteroid (BR)-mediated lamina joint inclination, BR-mediated coleoptile elongation
MAGGGGGGGRGEGEGRAATGKRERIAIRRIDNLAARQVTFSKRRRGLFKKAEELSILCDA
EVGLVVFSATGKLFQFASTSMEQIIDRYNSHSKTLQRAEPSQLDLQGEDSSTCARLKEEL
AETSLRLRQMRGEELHRLNVEQLQELEKSLESGLGSVLKTKSKKILDEIDGLERKRMQLI
EENLRLKEQVSRMSRMEEMQPGPDSEIVYEEGQSSESVTNASYPRPPPDNDYSSDTSLRL
GLSLFSSK*

5'UTR

chr03:4525475..4525692 (- strand) : 218 bp

CDS

chr03:4525236..4525474 (- strand) : 239 bp

chr03:4521353..4521431 (- strand) : 79 bp

chr03:4521038..4521102 (- strand) : 65 bp

chr03:4520578..4520677 (- strand) : 100 bp

chr03:4520451..4520492 (- strand) : 42 bp

chr03:4520264..4520305 (- strand) : 42 bp

chr03:4519965..4520119 (- strand) : 155 bp

chr03:4519808..4519832 (- strand) : 25 bp

3'UTR

chr03:4519405..4519807 (- strand) : 403 bp

FASTA

>Os03t0186600-01 class=Sequence position=chr03:4519405..4525692 (- strand)
ATTGGTGGTG GTCTCCATTG CTCCCTTCCT CCCTGCCTTT TTCTTCCATA AGTAGTAGTA GTAGCGGGAG TGGCCGCCGC
CGCAGCCATA GATCTGCGGC GCCGCGTATC TCGCGGCTGG TTTGGCTGGT GCGGTTAGCG GCTAGGGTTT TGGTTGTTTC
GTCTGATCGA TCCTCCCCGA TTTTGCGGCG GCGGTGGTGA ATTGGTGTGT GATCTGATAT GGCTGGCGGC GGCGGTGGCG
GGGGAAGGGG GGAGGGGGAG GGGAGGGCGG CGACGGGGAA GAGGGAGAGG ATAGCAATAC GGAGGATCGA CAACCTGGCG
GCGAGGCAGG TGACCTTCTC GAAGCGGAGG AGGGGGCTGT TCAAGAAGGC CGAGGAGCTC TCCATCCTCT GCGACGCCGA
GGTCGGGCTC GTCGTCTTCT CCGCCACCGG CAAGCTCTTC CAATTCGCCA GCACCAGGTA TGCATGTATA TACAGTTATA
CACACACCAA CACATATATG CTTCTCTCTT CCTCGCCGGC GTCTCCTTCG CTCGCTCGCA GTTATTTCTG TTTAATTTGC
TTGCAATTAA ATCTCGATCT GGGTGATGAT CTCTCTGTCG GTTCTTGGAA TATCGTACTA TTGTTAGGGC TCTTTGTCGA
TCGATCAGGG TTTCTTTTTT CTTCTGAAAT TTCCCTAATT GATTTGCCGG TAAGTTACGT TCTTCATTTT GGCGTGTTTA
ATTAGTATAA AATTTATCAT AATAAACATA AAATTCTAGT TTATCGTGCT TCTAATTGAG TTGTTCAGTT GAGGAGTTGA
GATTGAGGTC ATGGCTTTCC AATTTCGGAT TTTCGGTCAG CTCTTTTTTC TTGGATATAC TCCATATACA CAACAGTGAT
AGATGTGTAT ATTTTTTCTC ATCATCGGCT CTTTCAATCT TAAAACAGTT TTGTCTTTGG TTTATATAGA ATTCGCTAGT
GTGTGTACTG TGTAAAATTC TTTCAATCCT ACAACAGTTT TGTCTTTGTC TTTTGCTTTC TCTGATTCTA CAAAATGCTT
TTGATTGTTC GGCGCTTTGA TTCATTTTCT TCTAGATGAG TAATGTAATA TGTTCTTCTA GGGAATGTTC TTTAATTCCC
AGGAAAAAAA TGTCCCAGCT TCTTAAATAG AGCTCTCTGT ATATGATGTT ATTAATTATA GCTCCATAGT GCGCTTAATT
TGAAATATTG TTTAGCACTT ATGTCGTGTT CTCTTCTATC TTTCACTCGA CCCATTTTTT ATAATGAAAA TGGTTAATTT
ACACCGATAG GCACACGGCT ATATATATAT AAGCATATAT AGTTTTTTTT TTCACTCTTG AAGTCAGCAA TCTTATTCAG
TTAATTTAAG ACCGTATGGA AGAGACTCGG CAGAGAGGGG TGTTTTCTCT CTTTTGGACT GGATGACCAG AGATAAATAG
CAGATTTTCT TGGGAAAAAA AAACTAAAGT AGGACAGGTT TTGCATGCAT GTGTGAAAGC ACTCGTGGAA AACTTACCCT
GTTCTCGCAT GATTTGATGT GTAGTTGTTA TACATATAGA TAACCATATC TACATTATTG CTTCTGGTTG GATCTTCTCA
TAAAACTGCA TCTTTCTCCA TCTTTTTCTA CAAGCTCAGT GGACTTCCAA GTATCTTCTC TGCTAATTTC TTGACACTGC
CGTTCTTTCC ACGTTTGTTA CATTATTGCT TTTGACATCA CTATTTTAAT TAATTAGATC TTGTAGACAA CACCCTGGAC
GCTTATCAGG AAACAGACTA TATATCGTTC AAAGTTTTTT GTTGAAATTT TAACTCGTAA AAACCATCTG GTTTTAGTTA
ATCTCATCGA TATTATTTTC TTCATTAAAG CAGGAATAAG AAGGCATGTA GTTTGTACAT GCATATATAT ACTGAAATTA
ATTATTACAG CTTTCAGAGA TCAGCAGCAG ATTTGTCATG ACAATTACAT ATTCTTCATG CATGAGTAAT ATATATATAT
ATATATATAT ATATATATAT ATTCAATTCT GTTGCTTTTG TCACGAATAG TTGTTAGTTT TAACCGAGCG TGCTTAAACt
gaccattatt tttaagcaac ttcaaaataa aaaggtttaa gtccaactca ttcataaatt atttttttat tacaaatcta
atggtataac tttgatgcta aatactaact agatttctta aaaatattgt tggtcaaaca tagcTAGGCA ACTCAATGAA
AACTAACAAC TATTTAATTC AAATTATTTT TAATGGATAT GGTATATATC GGTATACAGT CTAATTAATT TGTCAACTGA
ACTTGGGTTA CTGATGGTTC TAACCATTGT GTATACATAT ATGCAAACAA ATTTAGTCCT AATTATATGT CGTAACATGA
GGGTACGTAC TGTGTTGATC GTTTTGTGTT ATGAACTAAT CACATGGAAA GAAGTGCATA TATATATCTA ATGTCAAGAG
TGTTGTTAAC TGATACCCCA CATATATATA CCAGAATGTT TACAGTGTTA ATTAACACAT GGCAAAATCA AGCAAAAATA
CAACCAATCT AAACTTGTTA ATTGTTCAAT CTTTGTATTC GGGGTAACTA ATTAAGCTAG AGCTGTCAAA CGAAACGACC
TCTGATAGTA GCACACATAT ATGGGATTCT CCAAAGTGAT AGGTTTGCGA CTGTTAATTG TTTGTTTTTT TTTTCTCCAC
AAGCGACGAC AGAAAACTAG CTAGTCGATC TATTCTTTTC ATGTACATCA CTTACACTAT TTGCCAGTGC ATGACATGAT
CTATCAGCAT GCATGGATAT AGAGTGTGCA TACCAATTGG CCTGGTAGCT AGAAAAAGAT TGACCAATCC AATCAAATGG
ATCCCTGAGC TTACGTACCG CTATCAGAGT TTGTCCAAAt atattttcaa ttataatata taaaaatata agtagatatt
taattttatt aaagtacttt ttaaaactaa tctatgttcc agtgtttttt taagctaaat atttaaaatt gttaaagttc
TAGTCAAACA TGATAATTAT GGAATTAGAA GGAGTACGTA CATAAGAGCA AGTATAATAA AACTCAAGAT CGTGCTTATA
AGACTCAAGT GTTGTCTTTT AACAGTGTTA TGTTGCATTT GGTGATGAGT GTGGGGTAAG TGAGGAGAGA GAGAACGAAC
AATCTCTCAG TATAAAAAGC AGCCTCTACA TAATTTAAAA AGTGCAAATA CTAGTGTGAT AGTAAACAAA TAAATAACAT
TAGAGTTTGT GTATTATGGA TGAGATATAT TGTACTACCT TTGTCTCTAA ATACAAAAGA TTTTGCTTAT GTAGATATAT
ATATGGGCAA AATCTCTTAA GATGAAGGTA GTACACATGT TTTATATATA TATATACACC TCCTGATCGA ATCGATGAGG
AGATATGAGG GATAAAATTA AAGGCGGTAG ACATCTCTAT TATTAAACTT GGCTAGCACT ACTACTAGTC TACATGTATA
AACATGAAAC CATTAATCAC ACACACAGAG AGATAAAAGA Aaaaaaacaa gaaaacaaca gaaatgactg cttaaatgga
gcatatatag aaaaaacata atataattat tggaagatag atagatgcaa agaatatttt ctaaaagatt ggacctcaag
ttaaaagttc tctaatatcc ctatgattcg agccaaccat aaggaatttc ataggaattt ggaatgacta ttccttCGTT
CCGATTAGAC ATATATATAG GGTTTTCTCA ACTTTATAAA ATTTATTTAA ATTTCCTTTG TTTGAAAAGA GCCATAAGAT
ATAGTACTAG TTCATCATGT CATAATACAT AACAAGAACC ATAAGATATA GTCATGTGTC TTCGTCTTCT AGACTTCTAC
TATTCCTGCT GCCTGTGCCA TGTCATGCAT GCATGGTCCA TGCATGAAAT ATTGATGGCC ACAGAACAAG CTACGCGTGG
CTTACCTCTT CACAGAAGCA ATTGTATTTT CTTCTTCTCG TTCTCTGAAA CAATCAATAT GGTAGTTCAG AACATTCATA
TCCTTCCAAT ATGGTAGTTC AGAAGCAATT GTATTTTGAA GGGCCTAGAA GAACTACCTA ACAATATTTG GTACTACTAG
CATCTTGATG AAAACGTTTG GATTCAACAT TACAAACCTT AGCTAGCTCT ACAAACATCC AACTCTGTCT AACTTTGTTT
TCTATATATA CATTGATGAA GCATGGAACA GATTATTGAC CGGTACAACT CGCATTCCAA GACACTTCAG AGAGCAGAAC
CTTCTCAACT CGACTTACAA GTAAGCTGAA AATACTTTCA CTTGTATTAC AAAAGAGAAA TGCAACAGCT ATATGTGATG
TTGATGATCG ATATACCCTC TCATATCACT CAACTTTCTA GAAAGAATTA GTGTGGACCT TAATTAATTA GTCAGTTCTT
AAGAAACTGT TGCTAGTGGT ACTTCTCTGA ACATTTCATA TCGTTTATCA TCATACAAGC AAGAAATAGT ACATGTATCC
CTAACTGCAT TTATTCATGT CATCTGGTAG GGGGAGGACA GCAGTACTTG TGCCAGACTA AAGGAGGAGC TTGCAGAAAC
TAGCCTTAGG CTGAGGTACA TACTTATAAC TATATATAGA CTttgttcgg gagctggaga ttctgagaag cggctagtag
cgagctgctg agaaaactgg aCTTCCTATA ACTACATATT CTTAGAGAAT CTGAGAATCT GAAATGAACT GCTTGGGGAG
GTGGAGATTA CGTGAAAACT ATATATATAC AGCTGTAAAA ACTCCCCATA CAGGACCTAT ATACAGTTAC TGAGTACTAT
TACTTTTCAG AGAGAAATTA AATGCTACAT AAGATTACAC TATTTCAAGA GTTGTAGGTA CTGTCTAATT CTGTGGATTC
ACAGGATGGT TCAGCTAGTA TATGTGGCCA TTAATTCCCT TGTGTGTTCC TGCAGGCAGA TGAGAGGAGA GGAGCTGCAC
AGGCTGAATG TGGAACAGCT GCAGGAGCTA GAGAAGAGCC TCGAGTCCGG TCTAGGCTCT GTTCTCAAGA CCAAGGTACG
CGCAGCAACA TGAGACTGTC CATTGGACGT ACGTAGTTGC AATGTTGCAC ACCGTGATCT TTGATCATGT TCTTCTTCAG
AGCAAGAAAA TTCTGGATGA GATCGATGGA CTGGAACGAA AGGTAAGAGC ATGATATTTT GGCCAATCTC CAGCTTCAGT
ACACAGCTAC AGAGCGAAAC TGAAATGCAG CTGAAATTAA TTATCTTCTG TTAGATCTTG ATTTCTCTTT CTCATCACAA
AACTGCTCCA TTTGTGTGAT CAAACAGAGG ATGCAATTGA TAGAGGAGAA TTTAAGGCTG AAGGAGCAAG TAAGTACCCT
TAATTTTATC TGCCCTGTCG AAACTCGACA GAGGCTCGGA GATGTGAACC ATTTTCCATT ATCTAAAAAG AAAACTTTCT
CTCTATGCTT GCTCTGCTCG TTCATTTGAT TAAACGACGA TCTGAAGCTG CAGGTGTCCA GGATGTCAAG AATGGAGGAG
ATGCAGCCTG GGCCTGATTC AGAAATCGTG TACGAGGAAG GGCAGTCGTC TGAATCTGTC ACCAATGCTT CTTACCCGCG
ACCTCCACCC GACAACGACT ACAGCTCTGA TACATCTCTC AGGCTCGGGT GAGTTCTCCC ATACTTTCAG TTCCAACTCC
TACCTGAATT TATGTGTCAA GAAACAACAG AGGTTAGTTC GATGATGAAC ATTCAGGTTC AGATGATGAG TTGTTTACTG
ATTGATTTTG CATGTGGCAG GTTGTCACTC TTCAGCTCCA AGTGATGGCT GGAAACTAAA ACTGAGAGGA AACAGCTGGA
TGGCATGCCT GCATCGCCAA ATGATCAGTG CATGCACTGC AAGACTGCAA CAAATAACAC AGTTTTAGAT TGCCAGATGA
TGATGTGTGT GTGCTGAGAG TCACTGGCTA TTATCGTACA CATAATAACA ATAGAACGAA CAAGTTCTTC TGTTCTTGGA
TGTTACCTGA ATTCTACTCC CATACATGTT GTCAATGGCT CTGTAATCGA GTGTCTGCAA TTCCAGCTGA AAGCAACCGA
TTACAGGGAA ATAAGCTATT TTTTCTTAAA GTTCTAGCTA GCTTGGTACA GTTCATAAGC CGTAGAAAAA CAAAGGCAAA
TAGGACAATA Tatcaaaagt catttttagg taaagctttt atatctcc

Locus: Os03g0186600

Loading...

Locus: Os03g0186600

Loading...