Os03t0192700-01

Locus

Os03g0192700

Description

Myo-inositol 3-phosphate synthase 1, Phytic acid biosynthesis, Determination of phytic acid accumulation in grain

RAP-DB Gene Symbol Synonym(s)

INO1, RINO1

RAP-DB Gene Name Synonym(s)

myo-inositol 3-phosphate synthase 1, 1D-myo-inositol 3-phosphate synthase 1

CGSNL Gene Symbol

INO1

CGSNL Gene Name

INOSITOL 1-PHOSPHATE SYNTHASE-1

Oryzabase Gene Symbol Synonym(s)

OsINO1, MIPS, IPS, RINO1, OsINO1-1, OsRINO1, OsMIPS1, MIPS1

Oryzabase Gene Name Synonym(s)

inositol 1-phosphate synthase-1, Inositol-3-phosphate synthase, Myo-inositol-1-phosphate synthase, MI-1-P synthase, 1D-myo-inositol 3-phosphate synthase 1, rice myo-inositol-1-phosphate synthase, Ins(1)P1 synthase 1, 1L-myo-inositol-1-phosphate synthase 1, myo-inositol-1-phosphate synthase 1, L-myo-inositol 1-phosphate synthase 1

Transcript Evidence

AK058750

AK103501

Protein Evidence

O64437

Literature

PMID: 31619750

PMID: 19021878

Note

Manual Curation

October 21, 2019

Gene Ontology (GO)

Biological Process: inositol biosynthetic process (GO:0006021)

Biological Process: phospholipid biosynthetic process (GO:0008654)

Molecular Function: inositol-3-phosphate synthase activity (GO:0004512)

Functional domain (InterPro)

NAD(P)-binding domain superfamily (IPR036291)

Myo-inositol-1-phosphate synthase (IPR002587)

Myo-inositol-1-phosphate synthase, GAPDH-like (IPR013021)

Full-length cDNA

001-019-H08 (Online Clone Ordering)

J033131B11 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0192700-01)

Others

Oryzabase (6170)

Transcript

1913 bp

>Os03t0192700-01 Myo-inositol 3-phosphate synthase 1, Phytic acid biosynthesis, Determination of phytic acid accumulation in grain
CACAGCCTACCTAGCTTCTCCTTCTCGCTCGCTTCGCCCGCATAAGTCTAGCCACAAACC
CGCCGCCGCCGCCGCCGCCGCCGCCGCTAGCTTCCGCGGAGCGGGGCGAGATGTTCATCG
AGAGCTTCCGCGTGGAGAGCCCGCACGTGCGGTACGGCGCGGCGGAGATCGAGTCGGACT
ACCAGTACGACACGACGGAGCTGGTGCACGAGAGCCACGACGGCGCCTCCCGCTGGATCG
TCCGCCCCAAGTCCGTCCGCTACAACTTCCGGACCACCACCACCGTCCCCAAGCTCGGGG
TGATGCTCGTGGGGTGGGGCGGCAACAACGGCTCAACGCTGACGGCTGGGGTCATCGCCA
ACAGGGAGGGAATCTCATGGGCGACCAAGGACAAGGTGCAGCAAGCCAACTACTATGGCT
CACTCACCCAGGCGTCCACCATCAGGGTCGGGAGCTACAACGGGGAGGAGATCTACGCGC
CCTTCAAGAGCCTCCTGCCCATGGTGAACCCTGATGACCTTGTGTTCGGGGGCTGGGACA
TTAGCAACATGAACCTGGCTGATGCTATGACCAGGGCAAAGGTACTTGACATTGATCTGC
AGAAGCAGCTCAGACCTTACATGGAGTCCATGGTGCCTCTCCCCGGCATCTATGACCCCG
ACTTCATCGCCGCCAACCAGGGATCCCGCGCGAACAATGTCATCAAGGGCACCAAGAAGG
AGCAGATGGAGCAGATCATCAAGGACATCAGGGAGTTCAAGGAAAAGAGCAAAGTGGACA
AGGTGGTGGTGTTGTGGACTGCAAACACTGAAAGGTACAGCAATGTCTGTGTTGGGCTCA
ATGACACAATGGAGAACCTCCTGGCGTCTGTGGACAAGAACGAGGCGGAGATATCACCAT
CGACACTGTATGCCATTGCCTGCGTCATGGAGGGTATACCGTTCATTAACGGGAGTCCTC
AGAACACCTTTGTGCCTGGGCTGATCGATCTTGCTATTAAGAACAACTGCCTGATTGGTG
GTGATGATTTCAAGAGTGGACAGACAAAGATGAAGTCTGTCTTGGTTGATTTCCTAGTTG
GTGCTGGAATAAAGCCCACCTCAATTGTCAGCTACAACCACTTGGGGAATAATGATGGCA
TGAACCTTTCCGCACCTCAAACATTCCGATCCAAGGAGATCTCCAAGAGCAATGTGGTCG
ATGACATGGTCTCAAGCAATGCCATCCTCTATGAGCTTGGCGAGCATCCTGATCATGTTG
TTGTGATCAAGTATGTGCCGTATGTTGGAGACAGCAAGAGGGCAATGGACGAGTACACCT
CAGAGATCTTCATGGGGGGTAAGAGCACCATCGTTCTGCACAACACCTGTGAGGACTCAC
TCCTTGCCGCGCCGATCATTCTTGATCTGGTGCTCCTTGCCGAGCTCAGCACCAGGATTC
AGCTGAAAGCCGAGGGGGAGGAGAAGTTCCATTCCTTCCATCCAGTGGCTACCATCCTGA
GCTACCTCACCAAGGCACCCCTTGTTCCTCCTGGCACACCAGTGGTGAACGCCCTGGCAA
AGCAGAGGGCAATGCTTGAGAACATCATGAGGGCCTGCGTTGGGCTGGCCCCCGAGAACA
ACATGATCCTGGAGTACAAGTGAGGGAGGCTGCCGAGGCCGAGCAGCCGTGGCATGTGGC
AAAGAGGCGAATGGGATGGAGCAAGAAAGACGTGATTAGCTAGCTCTAAGAATTGTTTTA
GCTTCTCTTGTGATTTTTCGGTCTTTCCCATTCTTAACCTTCTGTGCTTTGTGTGAGACT
CTTATCGGGCTATGCAACTAGCAGCAGCCTTACTATGGTACTGGATGATGTTATGGAGAA
TGTTAGCTAGTTCCCCTCTATTTATAACTTATTAGTATCGGAGATTTCAGTTC

CDS

1533 bp

>Os03t0192700-01 Myo-inositol 3-phosphate synthase 1, Phytic acid biosynthesis, Determination of phytic acid accumulation in grain
ATGTTCATCGAGAGCTTCCGCGTGGAGAGCCCGCACGTGCGGTACGGCGCGGCGGAGATC
GAGTCGGACTACCAGTACGACACGACGGAGCTGGTGCACGAGAGCCACGACGGCGCCTCC
CGCTGGATCGTCCGCCCCAAGTCCGTCCGCTACAACTTCCGGACCACCACCACCGTCCCC
AAGCTCGGGGTGATGCTCGTGGGGTGGGGCGGCAACAACGGCTCAACGCTGACGGCTGGG
GTCATCGCCAACAGGGAGGGAATCTCATGGGCGACCAAGGACAAGGTGCAGCAAGCCAAC
TACTATGGCTCACTCACCCAGGCGTCCACCATCAGGGTCGGGAGCTACAACGGGGAGGAG
ATCTACGCGCCCTTCAAGAGCCTCCTGCCCATGGTGAACCCTGATGACCTTGTGTTCGGG
GGCTGGGACATTAGCAACATGAACCTGGCTGATGCTATGACCAGGGCAAAGGTACTTGAC
ATTGATCTGCAGAAGCAGCTCAGACCTTACATGGAGTCCATGGTGCCTCTCCCCGGCATC
TATGACCCCGACTTCATCGCCGCCAACCAGGGATCCCGCGCGAACAATGTCATCAAGGGC
ACCAAGAAGGAGCAGATGGAGCAGATCATCAAGGACATCAGGGAGTTCAAGGAAAAGAGC
AAAGTGGACAAGGTGGTGGTGTTGTGGACTGCAAACACTGAAAGGTACAGCAATGTCTGT
GTTGGGCTCAATGACACAATGGAGAACCTCCTGGCGTCTGTGGACAAGAACGAGGCGGAG
ATATCACCATCGACACTGTATGCCATTGCCTGCGTCATGGAGGGTATACCGTTCATTAAC
GGGAGTCCTCAGAACACCTTTGTGCCTGGGCTGATCGATCTTGCTATTAAGAACAACTGC
CTGATTGGTGGTGATGATTTCAAGAGTGGACAGACAAAGATGAAGTCTGTCTTGGTTGAT
TTCCTAGTTGGTGCTGGAATAAAGCCCACCTCAATTGTCAGCTACAACCACTTGGGGAAT
AATGATGGCATGAACCTTTCCGCACCTCAAACATTCCGATCCAAGGAGATCTCCAAGAGC
AATGTGGTCGATGACATGGTCTCAAGCAATGCCATCCTCTATGAGCTTGGCGAGCATCCT
GATCATGTTGTTGTGATCAAGTATGTGCCGTATGTTGGAGACAGCAAGAGGGCAATGGAC
GAGTACACCTCAGAGATCTTCATGGGGGGTAAGAGCACCATCGTTCTGCACAACACCTGT
GAGGACTCACTCCTTGCCGCGCCGATCATTCTTGATCTGGTGCTCCTTGCCGAGCTCAGC
ACCAGGATTCAGCTGAAAGCCGAGGGGGAGGAGAAGTTCCATTCCTTCCATCCAGTGGCT
ACCATCCTGAGCTACCTCACCAAGGCACCCCTTGTTCCTCCTGGCACACCAGTGGTGAAC
GCCCTGGCAAAGCAGAGGGCAATGCTTGAGAACATCATGAGGGCCTGCGTTGGGCTGGCC
CCCGAGAACAACATGATCCTGGAGTACAAGTGA

Protein

511 aa

>Os03t0192700-01 Myo-inositol 3-phosphate synthase 1, Phytic acid biosynthesis, Determination of phytic acid accumulation in grain
MFIESFRVESPHVRYGAAEIESDYQYDTTELVHESHDGASRWIVRPKSVRYNFRTTTTVP
KLGVMLVGWGGNNGSTLTAGVIANREGISWATKDKVQQANYYGSLTQASTIRVGSYNGEE
IYAPFKSLLPMVNPDDLVFGGWDISNMNLADAMTRAKVLDIDLQKQLRPYMESMVPLPGI
YDPDFIAANQGSRANNVIKGTKKEQMEQIIKDIREFKEKSKVDKVVVLWTANTERYSNVC
VGLNDTMENLLASVDKNEAEISPSTLYAIACVMEGIPFINGSPQNTFVPGLIDLAIKNNC
LIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKS
NVVDDMVSSNAILYELGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKSTIVLHNTC
EDSLLAAPIILDLVLLAELSTRIQLKAEGEEKFHSFHPVATILSYLTKAPLVPPGTPVVN
ALAKQRAMLENIMRACVGLAPENNMILEYK*

5'UTR

chr03:4829424..4829533 (- strand) : 110 bp

CDS

chr03:4829236..4829423 (- strand) : 188 bp

chr03:4828603..4828671 (- strand) : 69 bp

chr03:4828372..4828507 (- strand) : 136 bp

chr03:4827705..4827952 (- strand) : 248 bp

chr03:4827127..4827353 (- strand) : 227 bp

chr03:4826936..4827051 (- strand) : 116 bp

chr03:4826644..4826820 (- strand) : 177 bp

chr03:4826362..4826550 (- strand) : 189 bp

chr03:4826189..4826251 (- strand) : 63 bp

chr03:4825967..4826086 (- strand) : 120 bp

3'UTR

chr03:4825697..4825966 (- strand) : 270 bp

FASTA

>Os03t0192700-01 class=Sequence position=chr03:4825697..4829533 (- strand)
CACAGCCTAC CTAGCTTCTC CTTCTCGCTC GCTTCGCCCG CATAAGTCTA GCCACAAACC CGCCGCCGCC GCCGCCGCCG
CCGCCGCTAG CTTCCGCGGA GCGGGGCGAG ATGTTCATCG AGAGCTTCCG CGTGGAGAGC CCGCACGTGC GGTACGGCGC
GGCGGAGATC GAGTCGGACT ACCAGTACGA CACGACGGAG CTGGTGCACG AGAGCCACGA CGGCGCCTCC CGCTGGATCG
TCCGCCCCAA GTCCGTCCGC TACAACTTCC GGACCACCAC CACCGTCCCC AAGCTCGGGT ACGCACCCAT TACCCTCGCC
GATCGATCGA TCTGTCCACC GATCGCTTTC GATCCGGCGT CCGTCCTGTT CTCGTTTTCG TTTTCGTCTC CCGTTTGGTC
TCCGTGTTTT TCCTAGCTAT AGCTAGCGCC CGATCCAGCG AGATGTGGGA TGGCAAAAGG CCAAAGAGGG GGACTGCGAG
TCTGCGGCGC CTTTTGTTGC CTTGCTGCTC GGCCACCGTG GAAATTTGCC TGTCTCTGGG ATTCGATCCC GTCTGCTCAA
AACGACATTT CTTCTGAGTT TTTTTTATAT CCGCTAGTTT TTATTATTAT GGCTTTATCC CATGGCTGCA CCTGCACTGC
ATGTGAGGTT TCCATTAAAA TTTTGCATCT GCAAGATCGA GCAGGGGGAC CTACCTAGTA CCATATATAC CACTGGCAAG
AACTCCCAAA TTTATGACTG TTTATTAGCT TCTTTTATTA GTTCACCCCA TTTGTTTTGT TTTTTTTTCT GTCCATGTTG
GCTACGTGCC AGCACACTTG TCGATCATGT TTCTTGACCC AGTTTTATGG CTGTGGGTGC AGGGTGATGC TCGTGGGGTG
GGGCGGCAAC AACGGCTCAA CGCTGACGGC TGGGGTCATC GCCAACAGGG AGTAAGTGAT CACTCACGCT CTACTTTTCT
GCCTAAGCTA GCTTCATCTG TTTTTTCTTT TCTGAATTTA ACTGATGATG GTGTGAGTTT AATCAGGGGA ATCTCATGGG
CGACCAAGGA CAAGGTGCAG CAAGCCAACT ACTATGGCTC ACTCACCCAG GCGTCCACCA TCAGGGTCGG GAGCTACAAC
GGGGAGGAGA TCTACGCGCC CTTCAAGAGC CTCCTGCCCA TGGTAATCTG TCCTGTTTTC TTTGACATGC TAACCACGGA
AAAGATGGTA GTAGTAATAC ACTGCTAATG TGATAGTAGT AGTGCTAGTA CAATCATAAC ATGGCCTTGG CCTGTTTTAA
AGGCCAAGGT TCTAAATGAA AAGAAGAAAC TTTGACTTGT GGTCATGTCC TAAAAAAGAA AAAGATAAGT CCTGTCACAA
AAGGGTATCA AAAGATAAGT CCTGTCATAA AAGGGTGTCA AAAGGTGACC ATCGTGTGTC ACCTTTGTCA TGTTGTGATG
ATGCAAGTCA AAATGTTGTG GTACAACCAC AAGGTTCCAG CATCTTTGGA CAATGATTGA TCTGTTGAAT ACATCCACAA
ATAGTTTTCA GATTTGCAGA ACCTGTTTTT CCGTTTTCTG ATGGTTATGA AAAAAATTCA GGTGAACCCT GATGACCTTG
TGTTCGGGGG CTGGGACATT AGCAACATGA ACCTGGCTGA TGCTATGACC AGGGCAAAGG TACTTGACAT TGATCTGCAG
AAGCAGCTCA GACCTTACAT GGAGTCCATG GTGCCTCTCC CCGGCATCTA TGACCCCGAC TTCATCGCCG CCAACCAGGG
ATCCCGCGCG AACAATGTCA TCAAGGGCAC CAAGAAGGAG CAGATGGAGC AGATCATCAA GGACATCAGG TATACTGGCA
TGCATGGAAT TGAGCCCATT TTACTTCATA ACAAAAAGGA ATAGTATTCT GAATTAGTTA TGTCTACGAG GCATGAACAC
TAGGGGCAGA AATAACGGAA TACCTTCAGG CACCAGCTTA TAACAGAAAA TAGTATTCAC ATGATATGGT GTCAAAGCAC
TAAATATATA TTGGCACTTT CATATATCAA AAGGGCTCCC CGAAGAGTTA TACTACTGAA GTGAACTTGT TTCGTAAGAT
TAGTTCCAGT CTGCATTAAG ATGGTTGGAA CAACATGACA AACTTGTGAC TATGAATGCT GTAAACATTA GACATGATAT
TTTTTTTATT ACTTAAATAG GGAGTTCAAG GAAAAGAGCA AAGTGGACAA GGTGGTGGTG TTGTGGACTG CAAACACTGA
AAGGTACAGC AATGTCTGTG TTGGGCTCAA TGACACAATG GAGAACCTCC TGGCGTCTGT GGACAAGAAC GAGGCGGAGA
TATCACCATC GACACTGTAT GCCATTGCCT GCGTCATGGA GGGTATACCG TTCATTAACG GGAGTCCTCA GAACACCTTT
GTGCCTGGTA TGTAATTTTC TGTGTAGAGT AGTATGCGGT TTATTTTCTC AGGTTCATGG CTTATTTGTT TACTGTGTAC
AGGGCTGATC GATCTTGCTA TTAAGAACAA CTGCCTGATT GGTGGTGATG ATTTCAAGAG TGGACAGACA AAGATGAAGT
CTGTCTTGGT TGATTTCCTA GTTGGTGCTG GAATAAAGGT ACCAACCATA TATCAAATCC TTTGGCTAGC TTTTCGCATT
GAAACGTCGA TATTCTTCCG GAAACTTTTT TTTATATATA ACCTGATAAG AACTTTGGCT TTTGTTTTCG TAGCCCACCT
CAATTGTCAG CTACAACCAC TTGGGGAATA ATGATGGCAT GAACCTTTCC GCACCTCAAA CATTCCGATC CAAGGAGATC
TCCAAGAGCA ATGTGGTCGA TGACATGGTC TCAAGCAATG CCATCCTCTA TGAGCTTGGC GAGCATCCTG ATCATGTTGT
TGTGATCAAG GTTTGCAATT TGTCCATGGA TTCTTCTGCA GCAGTATGCC ATTAAAAAAA AACTTAGTTT TGGATTAAAA
CTTGTCCATG TATTCTTCTG CAGTATGTGC CGTATGTTGG AGACAGCAAG AGGGCAATGG ACGAGTACAC CTCAGAGATC
TTCATGGGGG GTAAGAGCAC CATCGTTCTG CACAACACCT GTGAGGACTC ACTCCTTGCC GCGCCGATCA TTCTTGATCT
GGTGCTCCTT GCCGAGCTCA GCACCAGGAT TCAGCTGAAA GCCGAGGGGG AGGTAAGAGT TCTGATGGAC TGAGATCAAT
TGACTCTCTG CTGCTCTGCA ATTGCCACCC TTTTTGCCAG CAAAATTGAC TATGTTGTTG TTTCACTTGT TATCCTGTGC
AGGAGAAGTT CCATTCCTTC CATCCAGTGG CTACCATCCT GAGCTACCTC ACCAAGGCAC CCCTTGTGAG TGCATACATG
CATCTGTACT GCCCATTAAC CGTTATGTTC TTTCATGATA TACCAACTGA TTTACTTATG TCACGAAAAA TTCGTCTCCT
GGAACAGGTT CCTCCTGGCA CACCAGTGGT GAACGCCCTG GCAAAGCAGA GGGCAATGCT TGAGAACATC ATGAGGGCCT
GCGTTGGGCT GGCCCCCGAG AACAACATGA TCCTGGAGTA CAAGTGAGGG AGGCTGCCGA GGCCGAGCAG CCGTGGCATG
TGGCAAAGAG GCGAATGGGA TGGAGCAAGA AAGACGTGAT TAGCTAGCTC TAAGAATTGT TTTAGCTTCT CTTGTGATTT
TTCGGTCTTT CCCATTCTTA ACCTTCTGTG CTTTGTGTGA GACTCTTATC GGGCTATGCA ACTAGCAGCA GCCTTACTAT
GGTACTGGAT GATGTTATGG AGAATGTTAG CTAGTTCCCC TCTATTTATA ACTTATTAGT ATCGGAGATT TCAGTTC

Locus: Os03g0192700

Loading...

Locus: Os03g0192700

Loading...