Os03t0201100-01

Locus

Os03g0201100

Description

Similar to Cyclophilin-like protein PPIL3b.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP65

CGSNL Gene Name

CYCLOPHILIN 65

Oryzabase Gene Symbol Synonym(s)

OsCYP65, OsCYP-9

Oryzabase Gene Name Synonym(s)

cyclophilin 65, cyclophilin 9

Transcript Evidence

AK102337 (DDBJ, Best hit)

Protein Evidence

XP_002866699.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein ubiquitination (GO:0016567)

Cellular Component: ubiquitin ligase complex (GO:0000151)

Molecular Function: ubiquitin-protein ligase activity (GO:0004842)

Functional domain (InterPro)

U box domain (IPR003613)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Full-length cDNA

J033091A16 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0201100-01)

RiceXPro (AK102337)

Others

Oryzabase (10076)

KEGG (Os03t0201100-01 (EC:5.2.1.8))

Transcript

2374 bp

>Os03t0201100-01 Similar to Cyclophilin-like protein PPIL3b.
AAACGCTCCTCGCCGTCAAATCTCCCCTCTTTCTCGCCGCCGGCGAGCAGCAGAAGCAGC
GGCACCAGCACCACCGGCTGTAGGCGCGATCTTGTAGGCTCATCGGAGATGGGGAAGAAG
CAGCATAGCAAGGACCGGATGTTCATAACGCGGACGGAGTGGGCGACGGAGTGGGGCGGC
GCCAAGCAGAAGGAGGCCGGCACGCCCTTCAAGCGCCTTCCCTTCTACTGCTGCGCGCTT
ACGTTTTTACCATTTGAGGATCCAGTGTGCACAGCAGATGGAAGCGTCTTTGATTTGATG
AGCATAATTCCATACATTAAGAAGTTCGGGAAGCACCCAGTAACAGGAACACCACTCAAG
CAGGAAGATCTAATGCCTTTAACATTCCACAAGAACTCAGATGGAGAGTTCCAGTGCCCT
GTTTTGAATAAAGTTTTTACAGAATTCACGCATATAGTTGCTGTAAAGACTACTGGGAAC
GTCTTCTGTTATGAGGTGGGGTTTGGCAATCCAAGAACTCAACATCAAGCCAAAGAATTG
GAGAGAATTGCTAACTGATGAGCCCTTTACACGAAATGACTTGATAACAATTCAGAATCC
AAATGCGGTTGATAGCAAGATCCTAGGTGAATTTGACCATGTCAAGAAAGGCCTCAAACT
TGAAGATGAAGAGTTGCAACGAATGAAAAATGATCCAACCTACAACATAAATATTTCTGG
TGATCTTAAGCAAATGATTAAGGAACTTGGAACTGAAAAGGGAAAGTTAGCTTTTTTGCA
TGGTGGGGGAGGGCAGAAAGCTCAAAAGGAAAGAGCTGCTGCACTTGCTGCTATATTGGC
AAAAAAGGAGAAGGATGACTCAAAATCTGGCAAAGAACCTAAACCTCATCAGCCTTTCAG
TATTGTAGATGCTGCTTCTGCTTCTGTTCATGGCAGAAGTGCAGCCGCAGCAAAGGCTGC
TACTGCTGAGAAAACAGCTGCTAGAATAGCAATGCACATGGCAGGAGATCGAGCTCCTGT
AAATGCTAAACTGGTTAAAAGCCGTTACACCACAGGAGCAGCTTCACGTTCTTTCACATC
AACTGCCTATGATCCTGTCACCAAAAATGAACTTGAGTATGTTAAGGTTGAAAAGAATCC
AAAAAAGAAGGGATATGTTCAGTTGCATACCACCCATGGTGATTTGAATTTGGAGCTTCA
TTGTGATATAACACCTCGGACATGTGAAAATTTCCTCACACATTGTGAAAATGGTTACTA
TAATGGTCTTATCTTCCATCGTAGTATCAAAAATTTCATGATTCAAGGAGGTGATCCAAC
TGGCACAGGAAGTGGAGGGGAGTCCATATGGGGTAAACCTTTCAAGGATGAACTGAATTC
AAAACTTATACATTCAGGAAGAGGTGTTGTCAGCATGGCTAATTCTGGGCCTCATACCAA
TGGGTCCCAATTTTTCATCTTGTACAAGTCCGCACCACATTTAAATTTCAAGCATACGGT
ATTTGGCATGGTGGTCGGTGGCTTGACCACTCTTTCGGCTATGGAAAAGGTTCCTGTTGA
TGATGACGATCGACCATTGGAGGAAATAAAGATATTAAAAGTAAGTGTATTTGTGAACCC
TTACACGGAACCAGATGAAGAAGAAGAAGAAAAGGCAAAGGAAGAGGAGAAGAAAAAGGA
TGAGGATTATGATAAGGTGGGATCATGGTATAGCAATCCAGGCACTGGCGTTGCTGGTTC
AACTAGCTCTGGTGGTGGCGTTGGCAAGTACCTAAAAGCTCGGACAGCTGGCTTTGCTGA
TGTGGTTGCAGATGATTCAAACAAGAAAAGAAAAGCGAGTGTGTCTAATGTAGAATTTAA
GGATTTCTCTGGGTGGTAGATTCCTGATGAACCTCCCCTTCTCTCAGAAGAAATGGCTAG
TGGAAACTTCGGTAGCAGCACTGTGGCATTTCTTCAATCTTCTGCTATGGATTTAAACTA
AGATGCTCAAGGTCCACAATTAAGATTCTCTGTAAGCAGATCCGAGTTGAGTAACATGAT
CCACTCTGGGTGGGTGTTTTGCGGCAAAAGAGTTGCACACTGAGCTATAAGAGGGATGCT
TGGGACTTAGGAAATTTGACTGGTTCAATAACTGGAAATTCATGCTTCCATCAGTCTGTG
TCTGAATTATTACAAATAAAACTTGAGAGGGCCGAGCCGCCGAGGGGATCTTAACTTTCC
CTCGTTGATTCGAAAAGCCTTTTACTGCCACAATCCGGGACTGCTGATATTGTTATGGCA
AGAGTTATGCTCAATCTGGAACTGTTGATATTGTTGGTTCATTGCATGTTTATACCGATA
AATTTGTATGCCAATAATCACTGAAATCAACTTG

CDS

450 bp

>Os03t0201100-01 Similar to Cyclophilin-like protein PPIL3b.
ATGGGGAAGAAGCAGCATAGCAAGGACCGGATGTTCATAACGCGGACGGAGTGGGCGACG
GAGTGGGGCGGCGCCAAGCAGAAGGAGGCCGGCACGCCCTTCAAGCGCCTTCCCTTCTAC
TGCTGCGCGCTTACGTTTTTACCATTTGAGGATCCAGTGTGCACAGCAGATGGAAGCGTC
TTTGATTTGATGAGCATAATTCCATACATTAAGAAGTTCGGGAAGCACCCAGTAACAGGA
ACACCACTCAAGCAGGAAGATCTAATGCCTTTAACATTCCACAAGAACTCAGATGGAGAG
TTCCAGTGCCCTGTTTTGAATAAAGTTTTTACAGAATTCACGCATATAGTTGCTGTAAAG
ACTACTGGGAACGTCTTCTGTTATGAGGTGGGGTTTGGCAATCCAAGAACTCAACATCAA
GCCAAAGAATTGGAGAGAATTGCTAACTGA

Protein

150 aa

>Os03t0201100-01 Similar to Cyclophilin-like protein PPIL3b.
MGKKQHSKDRMFITRTEWATEWGGAKQKEAGTPFKRLPFYCCALTFLPFEDPVCTADGSV
FDLMSIIPYIKKFGKHPVTGTPLKQEDLMPLTFHKNSDGEFQCPVLNKVFTEFTHIVAVK
TTGNVFCYEVGFGNPRTQHQAKELERIAN*

5'UTR

chr03:5301241..5301348 (- strand) : 108 bp

CDS

chr03:5301113..5301240 (- strand) : 128 bp

chr03:5300695..5300757 (- strand) : 63 bp

chr03:5300499..5300602 (- strand) : 104 bp

chr03:5300294..5300395 (- strand) : 102 bp

chr03:5300159..5300211 (- strand) : 53 bp

3'UTR

chr03:5300122..5300158 (- strand) : 37 bp

chr03:5299951..5300026 (- strand) : 76 bp

chr03:5299499..5299860 (- strand) : 362 bp

chr03:5299151..5299407 (- strand) : 257 bp

chr03:5298763..5299051 (- strand) : 289 bp

chr03:5298386..5298496 (- strand) : 111 bp

chr03:5297908..5298287 (- strand) : 380 bp

chr03:5297336..5297639 (- strand) : 304 bp

FASTA

>Os03t0201100-01 class=Sequence position=chr03:5297336..5301348 (- strand)
AAACGCTCCT CGCCGTCAAA TCTCCCCTCT TTCTCGCCGC CGGCGAGCAG CAGAAGCAGC GGCACCAGCA CCACCGGCTG
TAGGCGCGAT CTTGTAGGCT CATCGGAGAT GGGGAAGAAG CAGCATAGCA AGGACCGGAT GTTCATAACG CGGACGGAGT
GGGCGACGGA GTGGGGCGGC GCCAAGCAGA AGGAGGCCGG CACGCCCTTC AAGCGCCTTC CCTTCTACTG CTGCGCGTAA
TTACCCTTCC TCTACTGTTT TTGGAACTAG CCGGAAGGGA GATTTTCCTC CTTCTGTGTA TTCTGCTAGT CATTACTATT
CTGATTAGGG TTTGGGGAGA GCCTGAGCTT GTAGCTTTTC TTATTTAGTG CATAAACTTC ATTATTGCGC TTCCTGTTGA
TCTTTTAGTT GATATGTTAC CAGTTAAGGC GGTTAGCAAA GTATAGTAAT TTCTTTGTGG TCAACTTCAG TACTTGATGA
TATTTAACCT TTAGATTATG TTGATTGAGC TTAGTAGTGG ATGGATCTGT ATACCAAATG TTAATTTCCT CCGTTCTCCA
CTGATTATAA TTATTTGGTT TGGTGGTTTA GGCTTACGTT TTTACCATTT GAGGATCCAG TGTGCACAGC AGATGGAAGC
GTCTTTGATT TGATGTAAGT TCATTGTTCT TCTTTGTATA TGTTTTTGGA GAAAATATTA GAGACTGAGA TCCTGAAAAT
CCTGTGTTGG CTGTGTATAA ATGTAGGAGC ATAATTCCAT ACATTAAGAA GTTCGGGAAG CACCCAGTAA CAGGAACACC
ACTCAAGCAG GAAGATCTAA TGCCTTTAAC ATTCCACAAG AACTCAGATG GTGAGTTAAA CCGTCGCAAA AATTTCAGAG
TATCTTGAAC CAAATGTTAC GGTACATGTA CTCTTCTATC TCGGACATTA AATATCTGTC CTTTTTCTTG CAGGAGAGTT
CCAGTGCCCT GTTTTGAATA AAGTTTTTAC AGAATTCACG CATATAGTTG CTGTAAAGAC TACTGGGAAC GTCTTCTGTT
ATGAGGTGGG GTTTGGTGAG CTTTTTCAAG TGAACAATTT AGTATTATGG ACCTATGGTA CTTTTTAGCT CATGCATTCT
TGACTCATAA AATGCAGGCA ATCCAAGAAC TCAACATCAA GCCAAAGAAT TGGAGAGAAT TGCTAACTGA TGAGCCCTTT
ACACGAAATG ACTTGATAAC AATTCAGGTA TGTATTTAGA ACTGCATGTC TACTGTACTC AGTGTCAATT TGTTGACATT
TAGCCCTGTA ATCTAATTAT ATTCATCTTA TGAACTTTGA AGAATCCAAA TGCGGTTGAT AGCAAGATCC TAGGTGAATT
TGACCATGTC AAGAAAGGCC TCAAACTTGA AGATGAAGGT TGATTCCGGT CCCTCTTTCA CTCTTACTTC TTTCATATTG
CTATTTCCTA GTTAACTTAC ATGCTTTATC TGTATGACTG TTGCTCAGAG TTGCAACGAA TGAAAAATGA TCCAACCTAC
AACATAAATA TTTCTGGTGA TCTTAAGCAA ATGATTAAGG AACTTGGAAC TGAAAAGGGA AAGTTAGCTT TTTTGCATGG
TGGGGGAGGG CAGAAAGCTC AAAAGGAAAG AGCTGCTGCA CTTGCTGCTA TATTGGCAAA AAAGGAGAAG GATGACTCAA
AATCTGGCAA AGAACCTAAA CCTCATCAGC CTTTCAGTAT TGTAGATGCT GCTTCTGCTT CTGTTCATGG CAGAAGTGCA
GCCGCAGCAA AGGCTGCTAC TGCTGAGAAA ACAGCTGCTA GAATAGCAAT GCACATGGCA GGAGATCGAG CTCCTGTAAA
TGCTAAACTG GTACACTTTC GTATCATCTC AATGTATTTT GTCTGGTTTG TGTTACATAC GCAGTGGATT TTCTCTGATG
GAGATGATTC AATGATTTCA GGTTAAAAGC CGTTACACCA CAGGAGCAGC TTCACGTTCT TTCACATCAA CTGCCTATGA
TCCTGTCACC AAAAATGAAC TTGAGTATGT TAAGGTTGAA AAGAATCCAA AAAAGAAGGG ATATGTTCAG TTGCATACCA
CCCATGGTGA TTTGAATTTG GAGCTTCATT GTGATATAAC ACCTCGGACA TGTGAAAATT TCCTCACACA TTGTGAAAAT
GGTTACTATA ATGGTCTTAT CTTCCATCGT AGTATCAAGT ATGTTCTGAT CACATTAGTC CTTTTTACCT AGTCATTTGT
TTTATGCATA CTTATGGTCA TATCTAAATC TTATCTGTTT AATAATTCCT TTTACAGAAA TTTCATGATT CAAGGAGGTG
ATCCAACTGG CACAGGAAGT GGAGGGGAGT CCATATGGGG TAAACCTTTC AAGGATGAAC TGAATTCAAA ACTTATACAT
TCAGGAAGAG GTGTTGTCAG CATGGCTAAT TCTGGGCCTC ATACCAATGG GTCCCAATTT TTCATCTTGT ACAAGTCCGC
ACCACATTTA AATTTCAAGC ATACGGTATT TGGCATGGTG GTCGGTGGCT TGACCACTCT TTCGGCTATG GAAAAGGTTC
CTGTTGATGA TGACGATCGA CCATTGGTTA GTGTGATTGT TACTTTTACT TCCATCTGCA TTTTTAACTC GATTTTAAAC
ATGAACTATC ATAAATTTTG TTGCAAAACA GTTGCTATAA TATATGGATC CATTGGCTTT TATGCAATTG CAGTATGCTG
CTTTTTAAGG ATTGCTTTTT GTATTCATTT ATGTTTTAGC TTTGATTTGC TGTACTGGTT TATACTGCTG TTTTCTACTC
TTCTTCCGGT CTTCTTTTAA CATGTGATTC TTATTTCTTC CTTAATCTAC AGGAGGAAAT AAAGATATTA AAAGTAAGTG
TATTTGTGAA CCCTTACACG GAACCAGATG AAGAAGAAGA AGAAAAGGCA AAGGAAGAGG AGAAGAAAAA GGATGAGGAT
TATGTATGTT GCCTATCATC TTGTTTCTGT AATGAACTTG TGATCATGAA CTTGTTTCAT TTATTTATAT CATTTGTTTA
AAATTTTACT TGGTAATTCA GGATAAGGTG GGATCATGGT ATAGCAATCC AGGCACTGGC GTTGCTGGTT CAACTAGCTC
TGGTGGTGGC GTTGGCAAGT ACCTAAAAGC TCGGACAGCT GGCTTTGCTG ATGTGGTTGC AGATGATTCA AACAAGAAAA
GAAAAGCGAG TGTGTCTAAT GTAGAATTTA AGGATTTCTC TGGGTGGTAG ATTCCTGATG AACCTCCCCT TCTCTCAGAA
GAAATGGCTA GTGGAAACTT CGGTAGCAGC ACTGTGGCAT TTCTTCAATC TTCTGCTATG GATTTAAACT AAGATGCTCA
AGGTCCACAA TTAAGATTCT CTGTAAGCAG ATCCGAGTTG AGTAACATGA TCCACTCTGG GTGGGTGTTT TGCGGCAAAA
GGTATTACTA GATTCTTCTA CTGTAAACTT ATGTTGTGTC TTGTATAAAT CAAAGCCATG TTGTTAGCGG TTTCTTCTAT
ACAACAACAG ACTTCCCAAG CAAGTTGGTG TAAGCTAGAA ATGGAACTTC AATTCTAAGC CTTTAGCGTT TCTTATGTTA
GAGCAAGAGT CAACCCTGAT GAAAGTATGT GCATTTGACT GTCAGACAGT ATTTCTCGTG ACTATGAAAA GAGAGTTTTC
TCAATTTTAC CTTATTCTTT TCTCTGCAGA GTTGCACACT GAGCTATAAG AGGGATGCTT GGGACTTAGG AAATTTGACT
GGTTCAATAA CTGGAAATTC ATGCTTCCAT CAGTCTGTGT CTGAATTATT ACAAATAAAA CTTGAGAGGG CCGAGCCGCC
GAGGGGATCT TAACTTTCCC TCGTTGATTC GAAAAGCCTT TTACTGCCAC AATCCGGGAC TGCTGATATT GTTATGGCAA
GAGTTATGCT CAATCTGGAA CTGTTGATAT TGTTGGTTCA TTGCATGTTT ATACCGATAA ATTTGTATGC CAATAATCAC
TGAAATCAAC TTG

Locus: Os03g0201100

Loading...

Locus: Os03g0201100

Loading...