Os03t0205000-01

Locus

Os03g0205000

Description

CUE (coupling of ubiquitin conjugation to ER degradation) domain-containing protein, Regulation of cell death and defense response

RAP-DB Gene Symbol Synonym(s)

SPL35

RAP-DB Gene Name Synonym(s)

spotted leaf 35

CGSNL Gene Symbol

SPL35

CGSNL Gene Name

SPOTTED LEAF 35

Oryzabase Gene Symbol Synonym(s)

OsSPL35

Oryzabase Gene Name Synonym(s)

spotted leaf 35

Transcript Evidence

AK069442

Protein Evidence

Q10Q92

Literature

PMID: 30771255

Note

Manual Curation

February 20, 2019

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

UBA-like superfamily (IPR009060)

Ubiquitin system component Cue (IPR003892)

Experimentally confirmed subcellular location

cytosol (GO:0005829)

endoplasmic reticulum (GO:0005783)

Full-length cDNA

J023025N13 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0205000-01)

RiceXPro (AK069442)

Others

Oryzabase (23033)

KEGG (Os03t0205000-01)

Transcript

3114 bp

>Os03t0205000-01 CUE (coupling of ubiquitin conjugation to ER degradation) domain-containing protein, Regulation of cell death and defense response
GGGAAACCCCTCCGGAATCTACAAAGCCTACTCCTCTCCCTGTCCTGAAACGCCGTGACG
GCTTCTccttctccctcctccccccgatccagccatgtcgtccgcgccgccgccgcaGCA
ATCCAAACCCTCCTACAACCACCGCCGCCACAACAACGCCGCCCCGAGGCACCACCACGG
CCAGCAGCAGCAGCAGCCGCAGCCGCAGCCGCAGCCGCAGCAGCGCTACGTCCCCAAGCC
CGCCGCACCTAAACCCTCGCCCCCGCCGACGCTCACCACCGCCCTCCGATCATCGGCTTC
CCCGTCTGCATCTGGCGCCGGCAGGGTGGGCGGAGAGGCCGATGGGTTCGTGGCGTACCT
GCCGCACGACGAGGTGGTCGCGGCCGGGCTCGGCGGGCCCGACGCCCAGGAGTCGCAGGC
CGTCGTCGACCTCCTCAACGATGCCCTCGCCGCGCTCCTCCGCGCTAAGCCCCGCGAGTT
CTGGCGCCAGGTGGCACAGAATACTTCCCTGCATGAGTTCCTGGACAGTTACCTACAATT
CAGGCATCGGTGGTATGACTTGCCTCATCGTGCACCCAAAGGGACAGTTGCTGGCTTAGT
TGTCGGGGAGCTTGAGCTTTGCCGTCGAGTCTTTATGGTCCTGTACCGCATATCTTCAAA
CAAGGATCCTGGAGCATTCAGGGGTGAATCCCTTAGCATGAAGGAGCATGCAGCCCTCCT
GCAGGAGAAAAGATTGCTTGATTTACCCAAGTTGTTGGACATTTGTGCTATTTATGGGCA
TGACAATTGCAAATTGACAAGTTCACTGGTTGAAAACGCTATCAATGTCCAGCCAAATAT
TCTGGATGGCATTAATATTGTCCTTCCCCAATTCCTGGGCATTTTCCACACAATGCAGGA
GAGGTGCATGAAATCATTACAGGCGCTCACTTCATCTGGACCGAATGATAGTGGATATAC
CCAACTTCAGAAAGATTTCTCAGAGGTGTTGGATTTTGTAAACGATGCAATTGTCACTCT
GGATGCCTTTGTCGATGCTTATCAACCTGCTGCTTTATTATTTTGTACCTCTTTTGAGAC
GAGCTATGGAGTTGAGGAACTACTGAACACTCTTCCAAGATTGTATGACTCATTGTTGCC
ATCTTTGCTTCATGGGTTTCAAGTTATGTCCAGTTCCCAAAGCAATGGAGAGACTGCATC
TGACATTATACTGAGTGACATAGTTCTTGGTATAAGGATGCTGTCAAGGAGAACTGTCAG
TTTCGGATGGAGATTATTGGAGTTCTGCTATTTGAACAATCAACTTGTGGAGCGTGATGT
TGAAGCTTGTACAAAGATGTTTCCAGCTAAAGTCGAAGATCCTATGATCAGGGGTGACAT
CATAATTCAAACACTCAAGGATATCAATAGAGAAGCCACATTTTCACAAGATCATCCTGG
AAAGACATTCCTCCAAGCTCTTGAAAAGGAGTTCAAGTTGATGAACCGGATTGGAGATAT
TCGAAAGAAAGGATGGATACACATGGATGATGAGCAGTTCCAGTTCATTGCACGCTTGTG
TGGATCTACTCTGACATCTTGGAATAGTGTGCCTGATTTGCCTGTCTCTTCCTATGGTGG
TGAACTACAACATAAGAATGAGGATACTGCCATCACTGAGTCCAAGATTACTCAAATAAG
GGACCTCTTTCCTGATTATGGGAAGGGTTTCCTCGCTGCATGCCTGGAAGCCTACAACCA
GAACCCAGAGGAAGTTATCCAAAGGATTTTAGATGGAACCCTCCATCAAGATCTTCTAGC
TCTGGATACTTCATTAGAAGAGATGCCGCAGCTAAAGCCTGCAGCCACTGTTGGGAAAGA
TAAGGGCAAAGGAATACTTGTGGAGACTGAGCCTCAAATTATGAACAAACCCCATAAGGT
TAATACTGAGATGCATCGCTATGTTGAACATTCTTCATCTTCTTCAGTTCCATCAGCATC
CCAGGGACCATCCTCATCTGTACCATCAGTCCCGCAAGGTAGATTTACAAGGAAGACCAA
TGACGACGTGCCTGACTCTGCAACTCTAGACTCACAGAAAGCAAAAGATGCTGTTAGATC
AGCTGTGCTTGAATCCCAGTATGAATATGATGATGAGTATGATGACTCGTTCGATGATCT
TGGCTTCAGTGTGGTAGAATCAAGTTATGAGGAAACTGATGGTGCCAATGATGCCGAGAG
TTCCTCACAGGGCCCACGGTGGAGCTCACAAAAGAAGACACAGTTTTATGTTAAGGACGG
GAAGAACTACAGCTACAAGGTTGCTGGTTCAGTTGCTGTATCTAGTGCCCGAGAAGCGGC
TGTCCTGCGCAATGTTCAGAAAGATACCATTCATGGTCTTGGCCGTGGTGGAAATGTACC
TCTTGGAGTTCCCAACAGGCAACAACACAGAGACATGGAGGAAGAGGAGGGTAGCAATGC
AAACAACTTCGGCAGAGGAGGCTCCAACATAGGCAGAGGAGGCTCATATCCCCGTGGCGA
TCATGGCAGAAGAGGTGGAAGGGATCACGGCGACCCACCGCCGGAGGGCGAGAACCCAAA
CGGGCCACCAGGATTTGGCCGTGGTGGAAGAAGAGGGGGCAGAAATCACGGCAACCAGCC
AGAGGCAAACGAGAACCCGAATGGCCAACGTGGATTTGGCCGTGGCGCAACAAGAGGAGG
CAGGAACCATGACCATCCAGCGGAGGACCATGAAGATCCAGATGCAGCACAGGGCTTCGC
TCGAGGAGGGCCTGCACCTCGTGGAGGCAGAGGTGGAAGGAGAGGTGGTGGCCGGGATAA
CCATCACCGGAGAGACCGTGCGATGAAGAAGCATATGCAAGGATTGACAGGGCTTTAGTT
GATGGTTTTCACCATCGTTTTTCATTGCGGGAACTGTAAATGTGACAGTATTTTTTTTTG
ACGTGGTCTAGACTCGGCCAAAGCATACGATGCCTTGAAGCATCCTTATGATTACTACTC
GTATATTTTACCCATAGCATGTGGAATCAAACTATTGATGATCATATTTCTTGTAGCTTC
GGACAGAATACAAAGTTTGAATCTCATAAATGAAAGTTAAATCTGTGTTGCTCT

CDS

2784 bp

>Os03t0205000-01 CUE (coupling of ubiquitin conjugation to ER degradation) domain-containing protein, Regulation of cell death and defense response
atgtcgtccgcgccgccgccgcaGCAATCCAAACCCTCCTACAACCACCGCCGCCACAAC
AACGCCGCCCCGAGGCACCACCACGGCCAGCAGCAGCAGCAGCCGCAGCCGCAGCCGCAG
CCGCAGCAGCGCTACGTCCCCAAGCCCGCCGCACCTAAACCCTCGCCCCCGCCGACGCTC
ACCACCGCCCTCCGATCATCGGCTTCCCCGTCTGCATCTGGCGCCGGCAGGGTGGGCGGA
GAGGCCGATGGGTTCGTGGCGTACCTGCCGCACGACGAGGTGGTCGCGGCCGGGCTCGGC
GGGCCCGACGCCCAGGAGTCGCAGGCCGTCGTCGACCTCCTCAACGATGCCCTCGCCGCG
CTCCTCCGCGCTAAGCCCCGCGAGTTCTGGCGCCAGGTGGCACAGAATACTTCCCTGCAT
GAGTTCCTGGACAGTTACCTACAATTCAGGCATCGGTGGTATGACTTGCCTCATCGTGCA
CCCAAAGGGACAGTTGCTGGCTTAGTTGTCGGGGAGCTTGAGCTTTGCCGTCGAGTCTTT
ATGGTCCTGTACCGCATATCTTCAAACAAGGATCCTGGAGCATTCAGGGGTGAATCCCTT
AGCATGAAGGAGCATGCAGCCCTCCTGCAGGAGAAAAGATTGCTTGATTTACCCAAGTTG
TTGGACATTTGTGCTATTTATGGGCATGACAATTGCAAATTGACAAGTTCACTGGTTGAA
AACGCTATCAATGTCCAGCCAAATATTCTGGATGGCATTAATATTGTCCTTCCCCAATTC
CTGGGCATTTTCCACACAATGCAGGAGAGGTGCATGAAATCATTACAGGCGCTCACTTCA
TCTGGACCGAATGATAGTGGATATACCCAACTTCAGAAAGATTTCTCAGAGGTGTTGGAT
TTTGTAAACGATGCAATTGTCACTCTGGATGCCTTTGTCGATGCTTATCAACCTGCTGCT
TTATTATTTTGTACCTCTTTTGAGACGAGCTATGGAGTTGAGGAACTACTGAACACTCTT
CCAAGATTGTATGACTCATTGTTGCCATCTTTGCTTCATGGGTTTCAAGTTATGTCCAGT
TCCCAAAGCAATGGAGAGACTGCATCTGACATTATACTGAGTGACATAGTTCTTGGTATA
AGGATGCTGTCAAGGAGAACTGTCAGTTTCGGATGGAGATTATTGGAGTTCTGCTATTTG
AACAATCAACTTGTGGAGCGTGATGTTGAAGCTTGTACAAAGATGTTTCCAGCTAAAGTC
GAAGATCCTATGATCAGGGGTGACATCATAATTCAAACACTCAAGGATATCAATAGAGAA
GCCACATTTTCACAAGATCATCCTGGAAAGACATTCCTCCAAGCTCTTGAAAAGGAGTTC
AAGTTGATGAACCGGATTGGAGATATTCGAAAGAAAGGATGGATACACATGGATGATGAG
CAGTTCCAGTTCATTGCACGCTTGTGTGGATCTACTCTGACATCTTGGAATAGTGTGCCT
GATTTGCCTGTCTCTTCCTATGGTGGTGAACTACAACATAAGAATGAGGATACTGCCATC
ACTGAGTCCAAGATTACTCAAATAAGGGACCTCTTTCCTGATTATGGGAAGGGTTTCCTC
GCTGCATGCCTGGAAGCCTACAACCAGAACCCAGAGGAAGTTATCCAAAGGATTTTAGAT
GGAACCCTCCATCAAGATCTTCTAGCTCTGGATACTTCATTAGAAGAGATGCCGCAGCTA
AAGCCTGCAGCCACTGTTGGGAAAGATAAGGGCAAAGGAATACTTGTGGAGACTGAGCCT
CAAATTATGAACAAACCCCATAAGGTTAATACTGAGATGCATCGCTATGTTGAACATTCT
TCATCTTCTTCAGTTCCATCAGCATCCCAGGGACCATCCTCATCTGTACCATCAGTCCCG
CAAGGTAGATTTACAAGGAAGACCAATGACGACGTGCCTGACTCTGCAACTCTAGACTCA
CAGAAAGCAAAAGATGCTGTTAGATCAGCTGTGCTTGAATCCCAGTATGAATATGATGAT
GAGTATGATGACTCGTTCGATGATCTTGGCTTCAGTGTGGTAGAATCAAGTTATGAGGAA
ACTGATGGTGCCAATGATGCCGAGAGTTCCTCACAGGGCCCACGGTGGAGCTCACAAAAG
AAGACACAGTTTTATGTTAAGGACGGGAAGAACTACAGCTACAAGGTTGCTGGTTCAGTT
GCTGTATCTAGTGCCCGAGAAGCGGCTGTCCTGCGCAATGTTCAGAAAGATACCATTCAT
GGTCTTGGCCGTGGTGGAAATGTACCTCTTGGAGTTCCCAACAGGCAACAACACAGAGAC
ATGGAGGAAGAGGAGGGTAGCAATGCAAACAACTTCGGCAGAGGAGGCTCCAACATAGGC
AGAGGAGGCTCATATCCCCGTGGCGATCATGGCAGAAGAGGTGGAAGGGATCACGGCGAC
CCACCGCCGGAGGGCGAGAACCCAAACGGGCCACCAGGATTTGGCCGTGGTGGAAGAAGA
GGGGGCAGAAATCACGGCAACCAGCCAGAGGCAAACGAGAACCCGAATGGCCAACGTGGA
TTTGGCCGTGGCGCAACAAGAGGAGGCAGGAACCATGACCATCCAGCGGAGGACCATGAA
GATCCAGATGCAGCACAGGGCTTCGCTCGAGGAGGGCCTGCACCTCGTGGAGGCAGAGGT
GGAAGGAGAGGTGGTGGCCGGGATAACCATCACCGGAGAGACCGTGCGATGAAGAAGCAT
ATGCAAGGATTGACAGGGCTTTAG

Protein

928 aa

>Os03t0205000-01 CUE (coupling of ubiquitin conjugation to ER degradation) domain-containing protein, Regulation of cell death and defense response
MSSAPPPQQSKPSYNHRRHNNAAPRHHHGQQQQQPQPQPQPQQRYVPKPAAPKPSPPPTL
TTALRSSASPSASGAGRVGGEADGFVAYLPHDEVVAAGLGGPDAQESQAVVDLLNDALAA
LLRAKPREFWRQVAQNTSLHEFLDSYLQFRHRWYDLPHRAPKGTVAGLVVGELELCRRVF
MVLYRISSNKDPGAFRGESLSMKEHAALLQEKRLLDLPKLLDICAIYGHDNCKLTSSLVE
NAINVQPNILDGINIVLPQFLGIFHTMQERCMKSLQALTSSGPNDSGYTQLQKDFSEVLD
FVNDAIVTLDAFVDAYQPAALLFCTSFETSYGVEELLNTLPRLYDSLLPSLLHGFQVMSS
SQSNGETASDIILSDIVLGIRMLSRRTVSFGWRLLEFCYLNNQLVERDVEACTKMFPAKV
EDPMIRGDIIIQTLKDINREATFSQDHPGKTFLQALEKEFKLMNRIGDIRKKGWIHMDDE
QFQFIARLCGSTLTSWNSVPDLPVSSYGGELQHKNEDTAITESKITQIRDLFPDYGKGFL
AACLEAYNQNPEEVIQRILDGTLHQDLLALDTSLEEMPQLKPAATVGKDKGKGILVETEP
QIMNKPHKVNTEMHRYVEHSSSSSVPSASQGPSSSVPSVPQGRFTRKTNDDVPDSATLDS
QKAKDAVRSAVLESQYEYDDEYDDSFDDLGFSVVESSYEETDGANDAESSSQGPRWSSQK
KTQFYVKDGKNYSYKVAGSVAVSSAREAAVLRNVQKDTIHGLGRGGNVPLGVPNRQQHRD
MEEEEGSNANNFGRGGSNIGRGGSYPRGDHGRRGGRDHGDPPPEGENPNGPPGFGRGGRR
GGRNHGNQPEANENPNGQRGFGRGATRGGRNHDHPAEDHEDPDAAQGFARGGPAPRGGRG
GRRGGGRDNHHRRDRAMKKHMQGLTGL*

5'UTR

chr03:5489148..5489241 (- strand) : 94 bp

CDS

chr03:5488751..5489147 (- strand) : 397 bp

chr03:5487902..5488061 (- strand) : 160 bp

chr03:5487726..5487787 (- strand) : 62 bp

chr03:5487521..5487615 (- strand) : 95 bp

chr03:5487227..5487340 (- strand) : 114 bp

chr03:5486640..5486703 (- strand) : 64 bp

chr03:5486453..5486549 (- strand) : 97 bp

chr03:5485943..5486370 (- strand) : 428 bp

chr03:5483641..5485007 (- strand) : 1367 bp

3'UTR

chr03:5483405..5483640 (- strand) : 236 bp

FASTA

>Os03t0205000-01 class=Sequence position=chr03:5483405..5489241 (- strand)
GGGAAACCCC TCCGGAATCT ACAAAGCCTA CTCCTCTCCC TGTCCTGAAA CGCCGTGACG GCTTCTcctt ctccctcctc
cccccgatcc agccatgtcg tccgcgccgc cgccgcaGCA ATCCAAACCC TCCTACAACC ACCGCCGCCA CAACAACGCC
GCCCCGAGGC ACCACCACGG CCAGCAGCAG CAGCAGCCGC AGCCGCAGCC GCAGCCGCAG CAGCGCTACG TCCCCAAGCC
CGCCGCACCT AAACCCTCGC CCCCGCCGAC GCTCACCACC GCCCTCCGAT CATCGGCTTC CCCGTCTGCA TCTGGCGCCG
GCAGGGTGGG CGGAGAGGCC GATGGGTTCG TGGCGTACCT GCCGCACGAC GAGGTGGTCG CGGCCGGGCT CGGCGGGCCC
GACGCCCAGG AGTCGCAGGC CGTCGTCGAC CTCCTCAACG ATGCCCTCGC CGCGCTCCTC CGCGCTAAGC CCCGCGAGTT
CTGGCGCCAG GGTAACCGAA ACGCTCGCTT GTGCATTACT GTGCTCATGA AACCGTGTAG CTGGAAGGCG TGAATTGTTA
TTTTGGGATT GGGAAATCAG AGCTGAAAGC TTGGAAGCGA TAACTAGTTA ACCACTTAAT GTTCGGTGTT TACTGCTTGT
TTGCTTCAAT TGTGTTTGTT GAATGCATCT TCTGATGCTT CGGTCTCTGT GATTATCTAA GGCTACGGAT TATGTGTAAA
ATTCTAGTGT ATGCTTGTTC AAATGTCAGT TTGCACTTTT AAGCGCAAGA TAAAATGCGT GCAGTTAAAT TTATTACTAC
ATTTGCAGTT GAAGTGGCTA GTAGTTGCAT AAGCAAAGCA AAGCCTATGC AATCATATTC TTATCACTAT CATGACCTAT
GATCCTTTGA AATAGTTTTA ATGGGAAGGA ATTAATCCTA GTCCCTTCAG ATTGACAGGA ACTTCAGATT GACAGGAATA
ACTACCCTAC AATCAGAGGA ATTTGGCATT TTTTCTTATG CAAACTAAGC CTGAACAATA ATTGAGCGAG TAGATGAGTC
AACATAAAAG CTTGAGTTGA GGACACGCCT AGATCTGTGA TTATCCATTG TTTCACTCCT AGAATTTAAC TTATGAATAA
ATCCGCGTGC ATTTGAACTT TACCAATGGT TTCCTAATGC TTATCGTTAC CTTTTCCCAG TGGCACAGAA TACTTCCCTG
CATGAGTTCC TGGACAGTTA CCTACAATTC AGGCATCGGT GGTATGACTT GCCTCATCGT GCACCCAAAG GGACAGTTGC
TGGCTTAGTT GTCGGGGAGC TTGAGCTTTG CCGTCGAGTC TTTATGGTCC TGTACCGCAT GTGAGATTTA TACCATTTCG
CTATCTTTCT TGTATACATA TTTTTCATAA GATAATGCAC ACTGTTCAGA TTCACATGAG ATTTGTCATG ATATGGCTCT
TGTTTGGGTG GTAGATCTTC AAACAAGGAT CCTGGAGCAT TCAGGGGTGA ATCCCTTAGC ATGAAGGAGC ATGCAGGTGA
GATTAGAACT ACTCATATGA TCACTGTTTG AGTTTACCTT TTTTTAGAGC AGAATGGATA GTGACCATTG GTTCAAATAT
ACTATATTCA CGTTGTTCGG TTGTAGCCCT CCTGCAGGAG AAAAGATTGC TTGATTTACC CAAGTTGTTG GACATTTGTG
CTATTTATGG GCATGACAAT TGCAAATTGA CAAGTTCACT GGTTGGTTCC TGAAGTGTTT ATTATTGTTG TTGTTTTTCT
CCTTTTCATT TTGCAGACAG ATGCTAACTT AAATGCAAAT TCTAATTCAT TCCCTTAGTC TCAGATAACC TTTTTCTATT
CATTGGCATG AATACTTTTA TAATTTTATT AATAACAAGT GCACATTTTC TGTATCTGTA GGTTGAAAAC GCTATCAATG
TCCAGCCAAA TATTCTGGAT GGCATTAATA TTGTCCTTCC CCAATTCCTG GGCATTTTCC ACACAATGCA GGAGAGGTGC
ATGAAATCAT TACAGGTTAT TTTGTGATCT TCTTCATAAA TCACTGCACA TAGCTGTTAT AGGATTCTGT ATTCCTTTAT
CTGGTATGAA CATCCATATG ATATCATTAT AACAGCTGTT TTCACTTTAG TCTGTAGTCC CAATCGCATA TGCTAAAACT
TTTATCGTTT TCTGCAAAGG ATTCAGGTTA TTCATTTGTG CTATTGACGA ATATACTTGT TATTACTTGT TATATCTGTT
ATTGTTTCAA ATACTTTCTT CCCAGTTCCT TTCAACAACC ATGATACATT GCTTGGTAGG TTAGATAGAA AGTGACGATT
ATGATGTTTA CTATTAATTT GTCTCTGTTT CTTTTTTATC CTAAATTGAG ATTGAAGTAT GTTTTCTCAC CACGATTAAA
AGTTGAGGAC CTATGATATT GATATAAACT TGATCTTGTA GTTTCACACC TTCCTGATCT GATGACAGTT TAGTAGTTTA
CAGAAGATCT TGGAGAACTA TGCATAAAAA GAACTTAACC ATAATAAATT CATTTTAGGC GCTCACTTCA TCTGGACCGA
ATGATAGTGG ATATACCCAA CTTCAGAAAG ATTTCTCAGA GGCAAGTTTT ACCTATACTG CATAGTTTAT GATATGTCTG
CTGTCCTTTC ATCTGATTTT TCTATATTGT TGTAAATCCA ACTTCCTTCA GGTGTTGGAT TTTGTAAACG ATGCAATTGT
CACTCTGGAT GCCTTTGTCG ATGCTTATCA ACCTGCTGCT TTATTATTTT GTACCTCTTT TGAGACGAGG TGCGCTTCTA
CTCATCCAAC ACAATATTTG TTCGCTGTTC CCTTAATAGG CAATGATGCT TATCTACCAC TTAATTTGCA GCTATGGAGT
TGAGGAACTA CTGAACACTC TTCCAAGATT GTATGACTCA TTGTTGCCAT CTTTGCTTCA TGGGTTTCAA GTTATGTCCA
GTTCCCAAAG CAATGGAGAG ACTGCATCTG ACATTATACT GAGTGACATA GTTCTTGGTA TAAGGATGCT GTCAAGGAGA
ACTGTCAGTT TCGGATGGAG ATTATTGGAG TTCTGCTATT TGAACAATCA ACTTGTGGAG CGTGATGTTG AAGCTTGTAC
AAAGATGTTT CCAGCTAAAG TCGAAGATCC TATGATCAGG GGTGACATCA TAATTCAAAC ACTCAAGGAT ATCAATAGAG
AAGCCACATT TTCACAAGAT CATCCTGGAA AGACATTCCT CCAAGCTCTT GAAAAGGAGT TCAAGTTGAT GAACCGGATT
GGAGATATTC GAAAGAAAGG TAAATGATAA AAAATCTCAA TTAAATGCTT GGTTATTTTC ATGTTTGTAA AATTCCACAC
AACCTTAGTA TCCCACTATT ATTATTTCAG CCAAAATTGT CTCTTTAGTT TTTCATCCAT AAACAACATA TACGATCTAG
GAACTTTATT CAGAAGTTGT CATACAATTA TTCTACATAT ATGTACTGAA TTGCCTATGA TTCTATATTC TGTTACTATG
CCTGCTCTCG CCATCTATGC ATGAGTGGTT CTTAGAAAGC TTAAAACTTC CAGCTTGATC CAGCATATTG ATCTCAATGA
ATGGAAAGAG AAAGAGCCAA AACAGAATCT TATCTATATT TATATCTATA CTACTTAAAA TGTATACGTG GTGGTGTCTG
TTCTGCCACA CCATCCTTAC CACTGACATT TGGGTCCCAC AATCTATACT ATTACATCAC CCTCCAACAA GTCCTCCTAT
TTCACTGCTG GTTCTCCCCA AATTTTGAAT CACCTACTTG TTCAATAAGG AAAATCATAA AAGTACTACT TGGATTAACT
ATGTGCTTAA TTGACTTAAC TAGAAACTCA ATTTGTTTTC CGTTGCAACG CATGGACTTT TGGCTAGTAA AAGGAAAAGA
TGCTCTAGCT TCTGTTGTTT TGTTCTCATA AAGTTCACCA ATAATATTCC CGTATTACCC TACATTTGAT TTTATTTCTG
CTCGCGTTTG ATCATTCTGG CACTTTTGAG TTGTGTTCAT AAGACATCAC TTTTTCTGTT TTGGCTAGAT TCTGTTGTGA
AGACTGAAAG AGTTTGCTAA ACTGTCAGCA TTATTCTGTT GACATATATG CTGTATTTTC TTGTTATCTC AAGTTTATTG
ATTGTGTCAT AGTTTTATAT TGATGCCAAA ACCTTTGGTT GATGTATTCA ATATGTTCCT CCAATCGTAA ACAGGATGGA
TACACATGGA TGATGAGCAG TTCCAGTTCA TTGCACGCTT GTGTGGATCT ACTCTGACAT CTTGGAATAG TGTGCCTGAT
TTGCCTGTCT CTTCCTATGG TGGTGAACTA CAACATAAGA ATGAGGATAC TGCCATCACT GAGTCCAAGA TTACTCAAAT
AAGGGACCTC TTTCCTGATT ATGGGAAGGG TTTCCTCGCT GCATGCCTGG AAGCCTACAA CCAGAACCCA GAGGAAGTTA
TCCAAAGGAT TTTAGATGGA ACCCTCCATC AAGATCTTCT AGCTCTGGAT ACTTCATTAG AAGAGATGCC GCAGCTAAAG
CCTGCAGCCA CTGTTGGGAA AGATAAGGGC AAAGGAATAC TTGTGGAGAC TGAGCCTCAA ATTATGAACA AACCCCATAA
GGTTAATACT GAGATGCATC GCTATGTTGA ACATTCTTCA TCTTCTTCAG TTCCATCAGC ATCCCAGGGA CCATCCTCAT
CTGTACCATC AGTCCCGCAA GGTAGATTTA CAAGGAAGAC CAATGACGAC GTGCCTGACT CTGCAACTCT AGACTCACAG
AAAGCAAAAG ATGCTGTTAG ATCAGCTGTG CTTGAATCCC AGTATGAATA TGATGATGAG TATGATGACT CGTTCGATGA
TCTTGGCTTC AGTGTGGTAG AATCAAGTTA TGAGGAAACT GATGGTGCCA ATGATGCCGA GAGTTCCTCA CAGGGCCCAC
GGTGGAGCTC ACAAAAGAAG ACACAGTTTT ATGTTAAGGA CGGGAAGAAC TACAGCTACA AGGTTGCTGG TTCAGTTGCT
GTATCTAGTG CCCGAGAAGC GGCTGTCCTG CGCAATGTTC AGAAAGATAC CATTCATGGT CTTGGCCGTG GTGGAAATGT
ACCTCTTGGA GTTCCCAACA GGCAACAACA CAGAGACATG GAGGAAGAGG AGGGTAGCAA TGCAAACAAC TTCGGCAGAG
GAGGCTCCAA CATAGGCAGA GGAGGCTCAT ATCCCCGTGG CGATCATGGC AGAAGAGGTG GAAGGGATCA CGGCGACCCA
CCGCCGGAGG GCGAGAACCC AAACGGGCCA CCAGGATTTG GCCGTGGTGG AAGAAGAGGG GGCAGAAATC ACGGCAACCA
GCCAGAGGCA AACGAGAACC CGAATGGCCA ACGTGGATTT GGCCGTGGCG CAACAAGAGG AGGCAGGAAC CATGACCATC
CAGCGGAGGA CCATGAAGAT CCAGATGCAG CACAGGGCTT CGCTCGAGGA GGGCCTGCAC CTCGTGGAGG CAGAGGTGGA
AGGAGAGGTG GTGGCCGGGA TAACCATCAC CGGAGAGACC GTGCGATGAA GAAGCATATG CAAGGATTGA CAGGGCTTTA
GTTGATGGTT TTCACCATCG TTTTTCATTG CGGGAACTGT AAATGTGACA GTATTTTTTT TTGACGTGGT CTAGACTCGG
CCAAAGCATA CGATGCCTTG AAGCATCCTT ATGATTACTA CTCGTATATT TTACCCATAG CATGTGGAAT CAAACTATTG
ATGATCATAT TTCTTGTAGC TTCGGACAGA ATACAAAGTT TGAATCTCAT AAATGAAAGT TAAATCTGTG TTGCTCT

Locus: Os03g0205000

Loading...

Locus: Os03g0205000

Loading...