Os03t0205300-00

Locus

Os03g0205300

Description

Similar to Helix-loop-helix DNA-binding domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsbHLH129, bHLH129, OsRSL4, RSL4, DLN79, OsDLN79

Oryzabase Gene Name Synonym(s)

basic helix-loop-helix protein 129, ROOT HAIR DEFECTIVE-SIX LIKE 4, DLN repressor 79, DLN motif protein 79

Transcript Evidence

ab initio prediction

Protein Evidence

Q10Q90 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Functional domain (InterPro)

Helix-loop-helix DNA-binding (IPR011598)

Basic helix-loop-helix leucine zipper transcription factor (IPR024097)

Basic helix-loop-helix leucine zipper transcription factor, plant (IPR024102)

Expression Databases

TENOR (Os03t0205300-00)

Others

Oryzabase (15407)

Transcript

1026 bp

>Os03t0205300-00 Similar to Helix-loop-helix DNA-binding domain containing protein.
ATGATGGAGTCCTCGGAGGCGAGCTGGCACTCGTTCGATCCGTCAGTCGCAATGGAGGAC
TCGGAGGCGATGGCGCAGCTGCTCGGCGTGCAGTACTTCGGCAATGACCAGGAGCAGCAG
CAGCCGGCGGCGGCGGCGCCGCCGGCGATGTACTGGCCGGCGCACGACGCGGCCGACCAG
TACTACGGCTCGGCGCCATACTGCTACATGCAGCAGCAGCAGCATTACGGGTGCTACGAC
GGCGGCGCGATGGTGGCCGGCGGCGACTTCTTCGTGCCGGAGGAGCAGCTGGTGGCCGAC
CCGAGCTTCATGGTGGACCTGAACCTCGAGTTCGAGGACCAGCACGGCGGCGATGCTGGC
GGCGCTGGGAGCAGCGCCGCCGCCGCCGCCGCCGCCACCAAGATGACACCGGCGTGCAAG
AGGAAGGTTGAGGATCACAAGGATGAGAGCTGCACGGACAACGTCGCGAGGAAGAAGGCG
CGCTCCACGGCAGCAACAGTGGTGCAGAAGAAGGGTAATAAGAACGCGCAGTCAAAGAAG
GCGCAGAAGGGCGCGTGCAGCCGGAGCAGCAACCAGAAGGAGAGCAATGGCGGCGGCGAC
GGCGGCAATGTGCAGAGCTCGAGCACCAACTACCTCTCTGATGACGACTCGCTGTCGCTG
GAGATGACTTCGTGCAGCAACGTGAGCTCGGCGTCCAAGAAGTCGTCGTTGTCATCGCCG
GCGACCGGGCACGGCGGCGCGAAGGCGAGGGCCGGGCGCGGGGCGGCGACCGATCCGCAA
AGCCTCTATGCCAGGAAGAGGAGAGAAAGGATCAATGAACGGCTAAAGATACTGCAGAAT
CTTATCCCAAATGGAACCAAGGTGGACATCAGCACGATGCTTGAAGAAGCAGTTCACTAC
GTCAAGTTCTTGCAGCTCCAAATCAAGCTTCTGAGCTCGGATGATATGTGGATGTTCGCG
CCGATCGCGTACAACGGGGTCAACGTCGGGCTCGACCTCAAGATCTCTCCACCGCAGCAG
CAATGA

CDS

1026 bp

>Os03t0205300-00 Similar to Helix-loop-helix DNA-binding domain containing protein.
ATGATGGAGTCCTCGGAGGCGAGCTGGCACTCGTTCGATCCGTCAGTCGCAATGGAGGAC
TCGGAGGCGATGGCGCAGCTGCTCGGCGTGCAGTACTTCGGCAATGACCAGGAGCAGCAG
CAGCCGGCGGCGGCGGCGCCGCCGGCGATGTACTGGCCGGCGCACGACGCGGCCGACCAG
TACTACGGCTCGGCGCCATACTGCTACATGCAGCAGCAGCAGCATTACGGGTGCTACGAC
GGCGGCGCGATGGTGGCCGGCGGCGACTTCTTCGTGCCGGAGGAGCAGCTGGTGGCCGAC
CCGAGCTTCATGGTGGACCTGAACCTCGAGTTCGAGGACCAGCACGGCGGCGATGCTGGC
GGCGCTGGGAGCAGCGCCGCCGCCGCCGCCGCCGCCACCAAGATGACACCGGCGTGCAAG
AGGAAGGTTGAGGATCACAAGGATGAGAGCTGCACGGACAACGTCGCGAGGAAGAAGGCG
CGCTCCACGGCAGCAACAGTGGTGCAGAAGAAGGGTAATAAGAACGCGCAGTCAAAGAAG
GCGCAGAAGGGCGCGTGCAGCCGGAGCAGCAACCAGAAGGAGAGCAATGGCGGCGGCGAC
GGCGGCAATGTGCAGAGCTCGAGCACCAACTACCTCTCTGATGACGACTCGCTGTCGCTG
GAGATGACTTCGTGCAGCAACGTGAGCTCGGCGTCCAAGAAGTCGTCGTTGTCATCGCCG
GCGACCGGGCACGGCGGCGCGAAGGCGAGGGCCGGGCGCGGGGCGGCGACCGATCCGCAA
AGCCTCTATGCCAGGAAGAGGAGAGAAAGGATCAATGAACGGCTAAAGATACTGCAGAAT
CTTATCCCAAATGGAACCAAGGTGGACATCAGCACGATGCTTGAAGAAGCAGTTCACTAC
GTCAAGTTCTTGCAGCTCCAAATCAAGCTTCTGAGCTCGGATGATATGTGGATGTTCGCG
CCGATCGCGTACAACGGGGTCAACGTCGGGCTCGACCTCAAGATCTCTCCACCGCAGCAG
CAATGA

Protein

342 aa

>Os03t0205300-00 Similar to Helix-loop-helix DNA-binding domain containing protein.
MMESSEASWHSFDPSVAMEDSEAMAQLLGVQYFGNDQEQQQPAAAAPPAMYWPAHDAADQ
YYGSAPYCYMQQQQHYGCYDGGAMVAGGDFFVPEEQLVADPSFMVDLNLEFEDQHGGDAG
GAGSSAAAAAAATKMTPACKRKVEDHKDESCTDNVARKKARSTAATVVQKKGNKNAQSKK
AQKGACSRSSNQKESNGGGDGGNVQSSSTNYLSDDDSLSLEMTSCSNVSSASKKSSLSSP
ATGHGGAKARAGRGAATDPQSLYARKRRERINERLKILQNLIPNGTKVDISTMLEEAVHY
VKFLQLQIKLLSSDDMWMFAPIAYNGVNVGLDLKISPPQQQ*

CDS

chr03:5496772..5497269 (- strand) : 498 bp

chr03:5496390..5496686 (- strand) : 297 bp

chr03:5496240..5496305 (- strand) : 66 bp

chr03:5496061..5496126 (- strand) : 66 bp

chr03:5495851..5495949 (- strand) : 99 bp

FASTA

>Os03t0205300-00 class=Sequence position=chr03:5495851..5497269 (- strand)
ATGATGGAGT CCTCGGAGGC GAGCTGGCAC TCGTTCGATC CGTCAGTCGC AATGGAGGAC TCGGAGGCGA TGGCGCAGCT
GCTCGGCGTG CAGTACTTCG GCAATGACCA GGAGCAGCAG CAGCCGGCGG CGGCGGCGCC GCCGGCGATG TACTGGCCGG
CGCACGACGC GGCCGACCAG TACTACGGCT CGGCGCCATA CTGCTACATG CAGCAGCAGC AGCATTACGG GTGCTACGAC
GGCGGCGCGA TGGTGGCCGG CGGCGACTTC TTCGTGCCGG AGGAGCAGCT GGTGGCCGAC CCGAGCTTCA TGGTGGACCT
GAACCTCGAG TTCGAGGACC AGCACGGCGG CGATGCTGGC GGCGCTGGGA GCAGCGCCGC CGCCGCCGCC GCCGCCACCA
AGATGACACC GGCGTGCAAG AGGAAGGTTG AGGATCACAA GGATGAGAGC TGCACGGACA ACGTCGCGAG GAAGAAGGCG
CGCTCCACGG CAGCAACAGT AAGTACAAAA AAAATGTACA ATTAATGAAC TGATTAATCT TTCGTAATAA TCGGATTAAG
ATTCCTGACG ATGTGTGCAT CAGGTGGTGC AGAAGAAGGG TAATAAGAAC GCGCAGTCAA AGAAGGCGCA GAAGGGCGCG
TGCAGCCGGA GCAGCAACCA GAAGGAGAGC AATGGCGGCG GCGACGGCGG CAATGTGCAG AGCTCGAGCA CCAACTACCT
CTCTGATGAC GACTCGCTGT CGCTGGAGAT GACTTCGTGC AGCAACGTGA GCTCGGCGTC CAAGAAGTCG TCGTTGTCAT
CGCCGGCGAC CGGGCACGGC GGCGCGAAGG CGAGGGCCGG GCGCGGGGCG GCGACCGATC CGCAAAGCCT CTATGCCAGG
GTAGGTAGAA CTATGCGCGA GTTGCTGCAC ATTTTTGTTG CTCATCTGAA TCTGAATTTT TTTTTAACTG TCTTGCTTGA
ACAGAAGAGG AGAGAAAGGA TCAATGAACG GCTAAAGATA CTGCAGAATC TTATCCCAAA TGGAACCAAG GTAAGTTACT
TAAAAACCAT CTGATTCCAA AACCGCATCA ATCACAATAC TCCACAAAAG CCTCCACGAT ACTGAATTGC TCTGATCATG
CGAGGACTTG TTATTTTTTT CAGGTGGACA TCAGCACGAT GCTTGAAGAA GCAGTTCACT ACGTCAAGTT CTTGCAGCTC
CAAATCAAGG TAACCATAAG ACCCCTGATT CGAATCCAAG AGCCCAAGTT TTGCTTCAAT TCGCGCGTTG GTCTCTAATC
TTCCATAAGC TAAAGCAATG GGATTCATCG TTTTGCGCAG CTTCTGAGCT CGGATGATAT GTGGATGTTC GCGCCGATCG
CGTACAACGG GGTCAACGTC GGGCTCGACC TCAAGATCTC TCCACCGCAG CAGCAATGA

Locus: Os03g0205300

Loading...

Locus: Os03g0205300

Loading...