Os03t0209600-01

Locus

Os03g0209600

Description

Similar to MEtRS (EC 6.1.1.10).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK068726 (DDBJ, Best hit)

Protein Evidence

NP_191100.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: tRNA aminoacylation for protein translation (GO:0006418)

Biological Process: methionyl-tRNA aminoacylation (GO:0006431)

Cellular Component: cytoplasm (GO:0005737)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: aminoacyl-tRNA ligase activity (GO:0004812)

Molecular Function: methionine-tRNA ligase activity (GO:0004825)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Aminoacyl-tRNA synthetase, class 1a, anticodon-binding (IPR009080)

Valyl/Leucyl/Isoleucyl-tRNA synthetase, class I, anticodon-binding (IPR013155)

Rossmann-like alpha/beta/alpha sandwich fold (IPR014729)

Methionyl-tRNA synthetase (IPR014758)

Aminoacyl-tRNA synthetase, class I (M) (IPR015413)

Full-length cDNA

J013160O09 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0209600-01)

RiceXPro (AK068726)

Others

KEGG (Os03t0209600-01 (EC:6.1.1.10))

Transcript

2217 bp

>Os03t0209600-01 Similar to MEtRS (EC 6.1.1.10).
AACGCGACCCAACCAAAAACCCCTCCTCCTCTCGCCGCGGCCTCCATCGCCATGGCCGCC
GGGCGGGCCTTCCTCCGCGCCGCCCCCTCCTCGCTGGCCGCCGGCGCCGGACGCTTCGCC
TTCGCGTGCCCGACGGCCCTTCCCCTCACTGCCGCCGCCGCGGCGGCGACCGGGCCACAC
CGTCGCGGCCGCGGCCGATGCTACTGCTCCGCCTCCGATGCGCCGCCGCCGCCGCCATAC
GTGCTCACCACGCCGCTCTACTACGTCAACGCCCCGCCGCACATGGGGAGCGCCTACACC
ACCATTGCCGCCGACGCCATCGCCCGCTTCCAGAGGTTGCTGGATAAGAGGGTCGTATTT
ATTACCGGAACAGATGAGCATGGCGAGAAAATTGCCACTTCAGCAGAGGCTTGTGGTAGA
AACCCAAAGGATCATTGTGATACAATTTCCAATTCATATAAGATGCTTTGGGCTGATCTA
GACATAGAGTATGACAAGTTTATCCGCACAACTGATCGTAAGCATGAGGCAGTTGTCAAT
GACTTCTATTCCAGAGTGCTAGATAGTGGTGACATATATAGAGCAGATTATGAAGGACTT
TACTGTGTGAGCTGTGAGGAGTACAAGGACGAAAAAGAGCTTGGGGAAAACAAATGTTGC
CCAGTGCATCTAAAGCCTTGTGTACCAAGAAAGGAAGACAACTATTTCTTTGCCTTGTCA
AAATACCAGCATCAACTGGAAGATCTACTGACAAAAAATCCTAATTTTGTACGGCCATCA
CATCGCTTGAATGAGGTCCAAGGATGGGTTAAAAGTGGATTAAGGGACTTCTCTATTTCC
CGTGCATCTGTAGAGTGGGGTATTCCGGTGCCAAATGACACCAAACAGACAATATACGTG
TGGTTTGATGCATTATTAGGGTACATTTCAGCATTACTAGATGATGGGGAGAAGGCAAGT
TTACAACAAGCAGTTGAACGTGGTTGGCCTGCCTCCCTACACTTGATAGGAAAGGACATA
TTGCGGTTTCATGCAGTATATTGGCCAGCAATGTTAATGTCAGCAGGAATAAGTGTTCCT
GATGCAGTTTTTGGTCATGGATTTTTGACAAAGGATGGCATGAAGATGGGAAAATCATTA
GGCAACACACTTGAACCAAAGGATCTGGTAAACAGATTTGGAGTAGACTCTGTTAGGTAC
TTCTTCTTGCGGGAAGTGGAATTTGGCAATGACGGGGACTATTCAGAGGAACGCTTTATC
AATATAGTCAATGCGCATCTTGCCAACACCATTGGAAACCTCCTCAATCGCACACTTGGG
CTGCTAAAGAAGAATTGTAAATCCACATTAGCTTTTGACTCGATTGCTGCCGCAGATGGA
ATTTCATTAAAGGATAATGTTGAAAACTTGGTGGACAAGGCAAAGGATCAGTTTGAAAAT
CTTTTGCTGTCATCAGCATGTGAAACTCTTATGGAGATTGGTAACTTAGGAAACTTGTAC
ATTGATGAGCAAGCACCATGGTCTTGTTTCAAGCAAGGGGGTGAGAGTGCTGAAAAGGCA
GCGAAGGATCTTGTTATTATTTTGGAGACTATGAGAATAATTGCAATTGCACTATCACCG
ATCACCCCAAGCCTTTCTTTGAGGATTTATACACAGCTTGGTTTCACAGAAGACCAATTT
AGAACATTGAGATGGGAGGATACCAAATGGGGAGGTCTAAAGGCAGGTCAGGTAATGATG
GAGCCAAAGCCAGTTTTTGCAAGGATAGAAACAGAGACGGACGAGAAAGATCAATCAAGT
TCGAAGGCAACAAAAGGCGGGAAGAAGAAGGCAAGAAGTCAAGGACTTGTGGAAGCATGA
GTCAAGTTTGTGATGGTGTACATAGCATAAAACTACCTGCGACCTTGTCGCTTGGTGACA
AAGAAGGCCTGAAGCATTTTCTTGGGGCGAATTGGTTTCTGCAATTTTGTTCTAACACTG
GCTTTCCAATTCCAAGTAGTACATACTGATACTGATAGCTGAGTTAATTCCCCACTCCCG
CAATGTTTTATTCCAGTGAACGCAGCTATTGCTTCTGTTTGTTATTGGAATAATGGAGCA
TCCTGAGCTCATCCATCTTTATCGAATTTAGATTAAATCTTTTGTACGATTCCTAACATG
ACATTTATGGAATTGGGAGCACCCTATTTAAGAGGGAAAAGATGCATTTGATGGAGC

CDS

1809 bp

>Os03t0209600-01 Similar to MEtRS (EC 6.1.1.10).
ATGGCCGCCGGGCGGGCCTTCCTCCGCGCCGCCCCCTCCTCGCTGGCCGCCGGCGCCGGA
CGCTTCGCCTTCGCGTGCCCGACGGCCCTTCCCCTCACTGCCGCCGCCGCGGCGGCGACC
GGGCCACACCGTCGCGGCCGCGGCCGATGCTACTGCTCCGCCTCCGATGCGCCGCCGCCG
CCGCCATACGTGCTCACCACGCCGCTCTACTACGTCAACGCCCCGCCGCACATGGGGAGC
GCCTACACCACCATTGCCGCCGACGCCATCGCCCGCTTCCAGAGGTTGCTGGATAAGAGG
GTCGTATTTATTACCGGAACAGATGAGCATGGCGAGAAAATTGCCACTTCAGCAGAGGCT
TGTGGTAGAAACCCAAAGGATCATTGTGATACAATTTCCAATTCATATAAGATGCTTTGG
GCTGATCTAGACATAGAGTATGACAAGTTTATCCGCACAACTGATCGTAAGCATGAGGCA
GTTGTCAATGACTTCTATTCCAGAGTGCTAGATAGTGGTGACATATATAGAGCAGATTAT
GAAGGACTTTACTGTGTGAGCTGTGAGGAGTACAAGGACGAAAAAGAGCTTGGGGAAAAC
AAATGTTGCCCAGTGCATCTAAAGCCTTGTGTACCAAGAAAGGAAGACAACTATTTCTTT
GCCTTGTCAAAATACCAGCATCAACTGGAAGATCTACTGACAAAAAATCCTAATTTTGTA
CGGCCATCACATCGCTTGAATGAGGTCCAAGGATGGGTTAAAAGTGGATTAAGGGACTTC
TCTATTTCCCGTGCATCTGTAGAGTGGGGTATTCCGGTGCCAAATGACACCAAACAGACA
ATATACGTGTGGTTTGATGCATTATTAGGGTACATTTCAGCATTACTAGATGATGGGGAG
AAGGCAAGTTTACAACAAGCAGTTGAACGTGGTTGGCCTGCCTCCCTACACTTGATAGGA
AAGGACATATTGCGGTTTCATGCAGTATATTGGCCAGCAATGTTAATGTCAGCAGGAATA
AGTGTTCCTGATGCAGTTTTTGGTCATGGATTTTTGACAAAGGATGGCATGAAGATGGGA
AAATCATTAGGCAACACACTTGAACCAAAGGATCTGGTAAACAGATTTGGAGTAGACTCT
GTTAGGTACTTCTTCTTGCGGGAAGTGGAATTTGGCAATGACGGGGACTATTCAGAGGAA
CGCTTTATCAATATAGTCAATGCGCATCTTGCCAACACCATTGGAAACCTCCTCAATCGC
ACACTTGGGCTGCTAAAGAAGAATTGTAAATCCACATTAGCTTTTGACTCGATTGCTGCC
GCAGATGGAATTTCATTAAAGGATAATGTTGAAAACTTGGTGGACAAGGCAAAGGATCAG
TTTGAAAATCTTTTGCTGTCATCAGCATGTGAAACTCTTATGGAGATTGGTAACTTAGGA
AACTTGTACATTGATGAGCAAGCACCATGGTCTTGTTTCAAGCAAGGGGGTGAGAGTGCT
GAAAAGGCAGCGAAGGATCTTGTTATTATTTTGGAGACTATGAGAATAATTGCAATTGCA
CTATCACCGATCACCCCAAGCCTTTCTTTGAGGATTTATACACAGCTTGGTTTCACAGAA
GACCAATTTAGAACATTGAGATGGGAGGATACCAAATGGGGAGGTCTAAAGGCAGGTCAG
GTAATGATGGAGCCAAAGCCAGTTTTTGCAAGGATAGAAACAGAGACGGACGAGAAAGAT
CAATCAAGTTCGAAGGCAACAAAAGGCGGGAAGAAGAAGGCAAGAAGTCAAGGACTTGTG
GAAGCATGA

Protein

603 aa

>Os03t0209600-01 Similar to MEtRS (EC 6.1.1.10).
MAAGRAFLRAAPSSLAAGAGRFAFACPTALPLTAAAAAATGPHRRGRGRCYCSASDAPPP
PPYVLTTPLYYVNAPPHMGSAYTTIAADAIARFQRLLDKRVVFITGTDEHGEKIATSAEA
CGRNPKDHCDTISNSYKMLWADLDIEYDKFIRTTDRKHEAVVNDFYSRVLDSGDIYRADY
EGLYCVSCEEYKDEKELGENKCCPVHLKPCVPRKEDNYFFALSKYQHQLEDLLTKNPNFV
RPSHRLNEVQGWVKSGLRDFSISRASVEWGIPVPNDTKQTIYVWFDALLGYISALLDDGE
KASLQQAVERGWPASLHLIGKDILRFHAVYWPAMLMSAGISVPDAVFGHGFLTKDGMKMG
KSLGNTLEPKDLVNRFGVDSVRYFFLREVEFGNDGDYSEERFINIVNAHLANTIGNLLNR
TLGLLKKNCKSTLAFDSIAAADGISLKDNVENLVDKAKDQFENLLLSSACETLMEIGNLG
NLYIDEQAPWSCFKQGGESAEKAAKDLVIILETMRIIAIALSPITPSLSLRIYTQLGFTE
DQFRTLRWEDTKWGGLKAGQVMMEPKPVFARIETETDEKDQSSSKATKGGKKKARSQGLV
EA*

5'UTR

chr03:5721104..5721154 (+ strand) : 51 bp

CDS

chr03:5721155..5721433 (+ strand) : 279 bp

chr03:5721896..5722042 (+ strand) : 147 bp

chr03:5722135..5722284 (+ strand) : 150 bp

chr03:5722700..5722867 (+ strand) : 168 bp

chr03:5723840..5723964 (+ strand) : 125 bp

chr03:5724420..5724513 (+ strand) : 94 bp

chr03:5725350..5725448 (+ strand) : 99 bp

chr03:5726236..5726416 (+ strand) : 181 bp

chr03:5726557..5726672 (+ strand) : 116 bp

chr03:5727264..5727419 (+ strand) : 156 bp

chr03:5727732..5727860 (+ strand) : 129 bp

chr03:5728060..5728224 (+ strand) : 165 bp

3'UTR

chr03:5728225..5728581 (+ strand) : 357 bp

FASTA

>Os03t0209600-01 class=Sequence position=chr03:5721104..5728581 (+ strand)
AACGCGACCC AACCAAAAAC CCCTCCTCCT CTCGCCGCGG CCTCCATCGC CATGGCCGCC GGGCGGGCCT TCCTCCGCGC
CGCCCCCTCC TCGCTGGCCG CCGGCGCCGG ACGCTTCGCC TTCGCGTGCC CGACGGCCCT TCCCCTCACT GCCGCCGCCG
CGGCGGCGAC CGGGCCACAC CGTCGCGGCC GCGGCCGATG CTACTGCTCC GCCTCCGATG CGCCGCCGCC GCCGCCATAC
GTGCTCACCA CGCCGCTCTA CTACGTCAAC GCCCCGCCGC ACATGGGGAG CGCCTACACC ACCATTGCCG CCGACGCCAT
CGCCCGCTTC CAGGCAAGCA ACTAAAGCGA GCAAGCCTAT GCGCGCGCGT TTGCGTTCCA TTGCTGCTCG CGTTCTAATC
CCAGTCTAGG GATTTTGAGT ACGTCAAACT GTTGATACCT TAGAAATCTA TGGAGTTCTA ACACGTCCAA TTGTTTAAAT
GTCTCAAGTG AGGCCACTCA AGTGCATATA TGAACTGAGC AATTCATATG GGTTGTAGAG AACGATATGC CATTGTCAGG
TACTAGTATG AGTGCATATC GTGTCACTTT CTATTCATGC CCTTAATCTC GATGAATTTC ATATGGGGTT ACAATAAAAA
TACGACAACT TAAACCTGTG CAGTTTTGAT GCACGTTTTG TCTGTTCAAT GATCTGGCCA CCAATTTTTG ATTAATATTA
TTGGAATGAA ATGTGTAGTA TCTGTTGATC AGCTCTCGCA ATCTAAGTGT GTTAATGCTA CTTTTATGGT CGCAGAGGTT
GCTGGATAAG AGGGTCGTAT TTATTACCGG AACAGATGAG CATGGCGAGA AAATTGCCAC TTCAGCAGAG GCTTGTGGTA
GAAACCCAAA GGATCATTGT GATACAATTT CCAATTCATA TAAGATGCTT TGGGCTGATG TATGTCCACA ATTCTAGGTG
TTTTCATTCA CCACATGGAA TAAATGCTGA GCTCATTTTT TTCTTCCAAC TTTGTTACAC ATTTCTTGCA GCTAGACATA
GAGTATGACA AGTTTATCCG CACAACTGAT CGTAAGCATG AGGCAGTTGT CAATGACTTC TATTCCAGAG TGCTAGATAG
TGGTGACATA TATAGAGCAG ATTATGAAGG ACTTTACTGT GTGAGCTGTG AGGAGTACAA GGTAAGCTTC TGTTTTTACT
TCCCCATGTA GTAGTACTAC ACTACTTCTT CCTTTTAGGG GAATATAGAA GGGCACTTAC CTAATAAAAA AATATGATTA
ATGTAGGTAT TTGATAATGA TGTTCAGCAT GCAATCTTGC GAACAACATC CTGTGCCTAC AGATGTTTTA GGTTTTAACT
TTATAATTTT GGTCCTTCAG AAACCAGACA CAAAATATGT GAGTTTTGTT AAAAAAAAAA CTATTTGGGG ATTTTTTTTT
CTCTCGAAAA TGCCGGAGGA CATACTTTTA GGGGAATTAT TTTTCTGTAT TTTCGTTCTT TTCATGCTTT ACAGTTGTTG
CCATATTCAC TTATAGATCA TCCTTCTTTT TCCAACATTG GTAATTGTGC AAATTCTGGT TTTGTTTGAA GTACAGGACG
AAAAAGAGCT TGGGGAAAAC AAATGTTGCC CAGTGCATCT AAAGCCTTGT GTACCAAGAA AGGAAGACAA CTATTTCTTT
GCCTTGTCAA AATACCAGCA TCAACTGGAA GATCTACTGA CAAAAAATCC TAATTTTGTA CGGCCATCAC ATCGCTTGAA
TGAGGTGATG CTATAATCCT CATTCTTATG AATCAAAATT TGTTTTCAAT CTATTTTATT TTATCAATTT ATTGCACATT
GCTGGTGTAT TGAGTTAACA CACATCGTTG GTTTATTGAG TCATTGTACT TCGCTGCAAA CTGTGGTGAA GTGTAAAACT
GTCCGTTGGA ATGTTGACTC TAATTATATG AGTTGATTAT TGACAAATAA AGGACAAAAT AACTAGGTTA CACATATGTG
CTTGGAGGTC TGCCACAGTC ATGTTAAAGA ATATCTGTGT TACAGAGTAT CAAATATGTA CAGTTACAAA CCAAACTACG
TCTGTTTCGT TAGGCCTTTC TTTTTGCTAC CAGGAAGTAC TGTTCGCATA CTGAACAAAC AACCTTGTAA TTTATTTTCT
TATGAAAAAC TTATCAAACT GTTATTCAGA TGGCATCCTA ACCAGTTAAT GATATGGTCA ACTCATTCAT CATATCTCCA
GGACTTGAAA AGGGCCTGAA TTTGGCCTAC TCACATGTGC CTTTAGTTTC TACAGTAATA TAAATGACTG TGAAGCTAAG
TGCATAACGC TTGAAATTTA GTCATTGTGT GATTCCTTTT CTTTTGACTT CTCAATGTGC ATATGTGGAG AAGTGCATGC
CAGAAGCAAG GACTGATGTG ACTCTTAACA TTTCTAAATT AAAACCTTCT ATTGTTTCCT GAAGAAAGCC AGAAAGGGCT
GTGCTTCTTC TTAAGTCACA AATATTGCGC TTACTATTAG AATCTTATGG GAATCAACTT GCCAGGGAAA CACATGTTCC
TTTTTTACTG TAATAATATA AACAGGCAAT TATCATGTAG TGTATTTGTA TTGTTCAAGA TTCATATTGA TGTTTTATAT
CATATGTTTA TGGACAGTCT TTCAGTATGC ATATGATTTT TGTTTGTGTT TTCAAATATA GTTGTTCTTT ACCCTTTCTG
ATTAAGACAG TTGTAGGTCC AAGGATGGGT TAAAAGTGGA TTAAGGGACT TCTCTATTTC CCGTGCATCT GTAGAGTGGG
GTATTCCGGT GCCAAATGAC ACCAAACAGA CAATATACGT GTGGTTTGAT GCATTATTAG GGTATGTTTC TCTGCTTCTT
TACATGATAT TCATTAATGT GTGCTCCTGT TTACTAGTCT TGCTGGGAAT TTATTATACT AGTCGTGCTT TTATTTCTTC
GAACTCACAA CTTTCTATAA ATAAATGAAG ACTGCTTCTG TTTCTAACTT TTAGTTGTTG TCCATGTTTA CATTTTCGTA
GTTCATTGAA TTCTTATGAT TCGTCGTTCC TGGATGTATT ACTGCCTGTA GTGTTTCACT CTACTCTCTG TTAAACTCTG
ATTTCTCTGA ATCTTCAGAA GTGTTCTGAT ATCTTATCTC TAATGGCACT CCTGATATAC CTCATGAATG TTTGTTATCC
ATTTCACCAT TACTACTAAA GATCCTATGC CTATAAATGA ATACATAATC TTATATATTA TCCCACTCTC TTTTTTTTTT
CAGACTGATT GTTTTATTTT CATATGTTGT GTTTAGGTAC ATTTCAGCAT TACTAGATGA TGGGGAGAAG GCAAGTTTAC
AACAAGCAGT TGAACGTGGT TGGCCTGCCT CCCTACACTT GATAGGAAAG GTGGATTTCA GGCGTATTAA CAGTTTCAAC
CATTCATGCT CCTTCTCATT TCTAGCAAAT TCTGTTTGCT TCTCTTCTCA TCTACCCTTA GTTTATTTGT TCACGTTGCT
TGATATGTTC TTGCGATGAT AAGGATAACT CTGGCGTGGG CTGATAACTA AGCACTGATG ATGCTTGAGT CTCAGAATAA
TCATCAACTA AGTATTAAAA AAACTGTGGT TCTATTGGGT TAATCATCAA TCCAGATTAT TGGGTTTTTT CATTCTATAA
TATTTTTAAT CATGTGTTAT TACAGTTTTC CATGCTCTAA CCTTATATTG GGCACTGTGA ACATTTCCTT TTAAATTTTT
ATCTCCTTGG TCTGTGCACA GATAGAGATG GTAGGTGGAA AATTATTCTG GAGTGGATTG GATGTTAATT TTGAAAATAA
TCGTTGACAA ATTCTTGTTC GGCATGCCTT AGTTGAAACT GTTTTGACAG AATTAGGCCC TGATAAAAAT TGACAGAAAT
AGGATTAGCT AGGACATCAA TGATAATCGG CCTTCTTCTA ATACGATAAA TCTGATTATT TTCACATTTT TCCTGACTCT
TATAATGCCA AGACACACTT TACTTCTCTT TATCTACTGC TTTGAGTATT TGTACTATTC CTTCTCCATT GTAATATAGG
GCTGTAGTTA ATGCTGACAG ATTTATCTGG CATCACCTAT GCAGTGGACA TTGATATTTA TGTCCAGTGT ACAGGCAAGA
ATGTTGGATG AACTTCTTGA GTTTTATTTC TATTTTTTAT TTTGTTATAA TATGGTTTAT GATGATTCTT TGTACATCTA
CCTCAGGACA TATTGCGGTT TCATGCAGTA TATTGGCCAG CAATGTTAAT GTCAGCAGGA ATAAGTGTTC CTGATGCAGT
TTTTGGTCAT GGATTTTTGA CAAAGGTGAT CCTACCTATT TTCATCGTTA TTATTTCCAT TTCTACAGAT CGATGACAGC
ATAGCACTGT ACCATAAGTA AACAGTAATG GAACCTGTTT TTCCTGCAAC TCATGTTCAT TTTCCTGATC CGAACATTTG
GATGTCCATG CTGGATGATG ATTATTATTA TTTATCCTAA TGTTCTGTTT ACAGCTTTAA CATCCCTTCT TAAAAATAAA
CTCTCCAGGA GCATGAAGAA GCTATATACT TCAATTCTAT ATTAAAAAAA AATCCTGGAC TACCCTCTTA TAGATCTTTA
CAAAATATCA TCTCTATGAC TCTACCGTAG CATGCACCGT GTTTTGCTTT AGATAGCAGT CTATGTTTTC TGCTGATTAT
AGTGTATATG GGCTTTCCTC TTATGTTGGT TGGTATCTCA AATATAGTCA TACAGGTAGC AGCAATGTAG CTTATAGAAA
ATATTATGTG GTTTTTTTGC CACATGTTCC GTGGTGTTAA AGTTTTATTT Atttatttat ttttgccggg tcggccgaaa
gattcggtcg accaatttca ttaagaGAGA GAGATAGATG TGGTGTTAAA GTTTGTAACT CTCGTACGCG ACCTTCCAGT
TGTAACTATT ATGTCTTCTA CATTATCTGG AAACAAATAT CAATCTTATA TTCCATGAGA AAGGTTTCAG TGGTGAACAT
AAAGAACTGT TTACAGGTTC TCTGTTTGCT ACTTATCTCA TCCAGTCACT TTTATTTCAT GCAGCAATGC TTTTTATTTT
GAAAAATTTT AGGATGGCAT GAAGATGGGA AAATCATTAG GCAACACACT TGAACCAAAG GATCTGGTAA ACAGATTTGG
AGTAGACTCT GTTAGGTACT TCTTCTTGCG GGAAGTGGAA TTTGGCAATG ACGGGGACTA TTCAGAGGAA CGCTTTATCA
ATATAGTCAA TGCGCATCTT GCCAACACCA TTGGTATTTC TACTCAAAGC ACCTTTGTTT CTGGAGTATA AAACGTCTTG
ATGGCTTTTA GATTTTTCTT TAGCTGGTGT AGAAGTTTTT CACCAATGCG CATCTTTATT TGTTGTTAAT GATCATTCTC
TCATCTTAAA CAGGAAACCT CCTCAATCGC ACACTTGGGC TGCTAAAGAA GAATTGTAAA TCCACATTAG CTTTTGACTC
GATTGCTGCC GCAGATGGAA TTTCATTAAA GGATAATGTT GAAAACTTGG TAAGTCCTCT TGGCATCTAT AAACTACAAT
TGGCGGAGTC AAGGAATAAC ATTTTAAATG ACAAATCTTT TGTTAAGTTC TTGTTGGGCA TGGCATGCTC AAAATCGCTT
TAGTAAAAGA CTTTGCAGAA AATAATTCTG AATGTACATT AAAAATCTTG AATTCTTGAA CATGTAGCAG TTGCTCCTCA
ACTGAATTAT AATATGCATA TGTTTTGGAG GTCACTTCAA GTCCATTTGT GCTTTTAATG TGTATATCAT TGAGATAAAC
TGATCATTTA TTGCTGTGTA GTATCTTCCA AATTTTTATT TATCAGCCTA CATGCTACAA CCAAATAAAC GGACCGACTT
TTACCATGCT AGCTAAACTG ATTCATGATT TATGCATATG CTATTCATTA TATTAGCACG TGATGGCAAG GACTTCACAT
GATTTTTGTC AGTGATATAT TGGTTTCATT TGTTCTTCCA AATCTGTTTT GCATCTGGAT ATTTCAGAAC ACCACCTGCC
ATCCATTTAC TCTTATCCGG ATCTTTGCAT GCTCTGTTGT GTATATGTTG GTTTGCAGAT GTATAAACTT TTTTATGCAG
GTGGACAAGG CAAAGGATCA GTTTGAAAAT CTTTTGCTGT CATCAGCATG TGAAACTCTT ATGGAGATTG GTAACTTAGG
AAACTTGTAC ATTGATGAGC AAGCACCATG GTCTTGTTTC AAGCAAGGGG GTGAGAGTGC TGAAAAGGCA GCGAAGGTAA
TTATTTAAAA TTGTCACAGT TTGTCTTACT TGTTTCAGAT TTCAGATGCC TGCATGAGTC TGAATGTACC GACCAGCATC
AATAAATAAA ATTTGCAATA TATTTTCTTC TGGTGCTATT AGATATAAGC CACAAAATCT GATCTCATGT GGAATAATCG
TTATAGGAAT TTGAAGCATT GAACTCATAT TTATGGACCT ATTTTTTTGC CTGTATTTTG GATTGGATTG AGACTAATCA
CATTGTTGTT TGGTTTGTGA TTTTGAGATA TAACTTGTTC AGTTAATTCT GCCTCCAACT ATCTTCAGGA TCTTGTTATT
ATTTTGGAGA CTATGAGAAT AATTGCAATT GCACTATCAC CGATCACCCC AAGCCTTTCT TTGAGGATTT ATACACAGCT
TGGTTTCACA GAAGACCAAT TTAGAACATT GAGATGGGTA TGCTCTTAAG ACTAAGTGAT ATTTCTCTTT ATTTATATTT
CCCAGTATTT CATGGTTATT ATCCTCGAAT ATATATAATC CAACACCCTT GCAGAAAATA CAAGGTTTGC ACACTAGTAT
TGTGAACCTG GAGGTTGGGT TTTCCTATGG TATGACTAGA CAACCTAGCA TATAATTTGT CAACTATGCC CTGCAGGAGG
ATACCAAATG GGGAGGTCTA AAGGCAGGTC AGGTAATGAT GGAGCCAAAG CCAGTTTTTG CAAGGATAGA AACAGAGACG
GACGAGAAAG ATCAATCAAG TTCGAAGGCA ACAAAAGGCG GGAAGAAGAA GGCAAGAAGT CAAGGACTTG TGGAAGCATG
AGTCAAGTTT GTGATGGTGT ACATAGCATA AAACTACCTG CGACCTTGTC GCTTGGTGAC AAAGAAGGCC TGAAGCATTT
TCTTGGGGCG AATTGGTTTC TGCAATTTTG TTCTAACACT GGCTTTCCAA TTCCAAGTAG TACATACTGA TACTGATAGC
TGAGTTAATT CCCCACTCCC GCAATGTTTT ATTCCAGTGA ACGCAGCTAT TGCTTCTGTT TGTTATTGGA ATAATGGAGC
ATCCTGAGCT CATCCATCTT TATCGAATTT AGATTAAATC TTTTGTACGA TTCCTAACAT GACATTTATG GAATTGGGAG
CACCCTATTT AAGAGGGAAA AGATGCATTT GATGGAGC