Os03t0212200-01

Locus

Os03g0212200

Description

Leucine-rich repeat domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIRL7

Oryzabase Gene Name Synonym(s)

intracellular Ras-group-related LRR protein 7

Transcript Evidence

AK069951 (DDBJ, Best hit)

Protein Evidence

B9F655 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Leucine-rich repeat (IPR001611)

Leucine-rich repeat, typical subtype (IPR003591)

Full-length cDNA

J023036E24 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0212200-01)

Others

Oryzabase (14437)

Transcript

1110 bp

>Os03t0212200-01 Leucine-rich repeat domain containing protein.
GAAGGGGAGAGAGCGCCGCGAGCGAGCGAGTTTGGCGGCGAGATGGGCTGCTGCAGCAGC
CGGAGCGCGGACTCGCCGGCCAGCCGCGTCACGCGCTGGCGCTCCACCGGGATCGTCGCC
CTCCGCGACGCCAGATTGAAGGTAGTACCAAATGAAGTTCTACAAGTAGGGAATTCCCTG
AGGATTCTGGATTTGACTAACAATAAGATAGCTGAGATTCCCCAGGAAGTTGGCACACTC
GTGAATATGCAAAGACTTGTTTTGGCTGGTAATTTGGTTGAAAGCATCCCAGCTAACATT
GGATATCTGCGGAATCTTAAAATCCTCACACTTGACAGAAATAAGATCTCTGTCTTACCT
GAAGAATTGGGTTCTCTATCAAATCTTCAACAACTCTCTATTTCTCAGAATTCTTTATCA
CGCCTGCCTAAGAGTGTAGGAGATTTGCGCAATAATCAAATAAACTCTTGATTCTATATT
TCCTCATATGAAATTTACGCAGCTTGTTACATTCCGTAAAGTTTCTTCTTTACTAATGTT
GCTACTCAATGTATCTGACAACAAACTAATTGCACTTCCTGAATCAATTGGAGGTTGCAG
TTCCCTGGAAGAATTGCAGGCAAATGGAAATTCAATTGAAGACGTGCCTTCATCAATCTG
TAACCTTGTTTGCCTCAAATCCCTATCATTGAACGGGAATAAGATTCGTCAGCTTCCCCA
AAACCTACTGAAAGACTGCAAGGCTCTTCAGAACATATCGTTGCATGACAATCCAATCTC
GATGGACCAGTTTCAACAAATGGATGGCTTTACGGAATTTGAGGCACGCCGAAGGAAAAA
ATTTGACAAACAGATTGATTCAAATGTCATGATGAGTTCCACAGCACTGGATGAAGGCAT
TGATTTGAACTAGTTTTTCAGAAATTTTATTTAGTTTATAATTACCCCATTAGTCAAAAG
ACCAACTGTAAATCTAGTGTACATATTAGTTTTTCCGATACTCTGATTTGGTAAAAAGAC
AAAAAAATGTATAACACACACTAATGAATGAACTGTGTAATTTTTGCAAATATTCAATGA
ATTAGGTGTACATCACCATCTTTGATCTAC

CDS

429 bp

>Os03t0212200-01 Leucine-rich repeat domain containing protein.
ATGGGCTGCTGCAGCAGCCGGAGCGCGGACTCGCCGGCCAGCCGCGTCACGCGCTGGCGC
TCCACCGGGATCGTCGCCCTCCGCGACGCCAGATTGAAGGTAGTACCAAATGAAGTTCTA
CAAGTAGGGAATTCCCTGAGGATTCTGGATTTGACTAACAATAAGATAGCTGAGATTCCC
CAGGAAGTTGGCACACTCGTGAATATGCAAAGACTTGTTTTGGCTGGTAATTTGGTTGAA
AGCATCCCAGCTAACATTGGATATCTGCGGAATCTTAAAATCCTCACACTTGACAGAAAT
AAGATCTCTGTCTTACCTGAAGAATTGGGTTCTCTATCAAATCTTCAACAACTCTCTATT
TCTCAGAATTCTTTATCACGCCTGCCTAAGAGTGTAGGAGATTTGCGCAATAATCAAATA
AACTCTTGA

Protein

143 aa

>Os03t0212200-01 Leucine-rich repeat domain containing protein.
MGCCSSRSADSPASRVTRWRSTGIVALRDARLKVVPNEVLQVGNSLRILDLTNNKIAEIP
QEVGTLVNMQRLVLAGNLVESIPANIGYLRNLKILTLDRNKISVLPEELGSLSNLQQLSI
SQNSLSRLPKSVGDLRNNQINS*

5'UTR

chr03:5853962..5854003 (+ strand) : 42 bp

CDS

chr03:5854004..5854102 (+ strand) : 99 bp

chr03:5854945..5855014 (+ strand) : 70 bp

chr03:5855399..5855445 (+ strand) : 47 bp

chr03:5855573..5855681 (+ strand) : 109 bp

chr03:5855861..5855946 (+ strand) : 86 bp

chr03:5856108..5856125 (+ strand) : 18 bp

3'UTR

chr03:5856126..5856189 (+ strand) : 64 bp

chr03:5856274..5856364 (+ strand) : 91 bp

chr03:5856710..5856795 (+ strand) : 86 bp

chr03:5856983..5857069 (+ strand) : 87 bp

chr03:5857155..5857465 (+ strand) : 311 bp

FASTA

>Os03t0212200-01 class=Sequence position=chr03:5853962..5857465 (+ strand)
GAAGGGGAGA GAGCGCCGCG AGCGAGCGAG TTTGGCGGCG AGATGGGCTG CTGCAGCAGC CGGAGCGCGG ACTCGCCGGC
CAGCCGCGTC ACGCGCTGGC GCTCCACCGG GATCGTCGCC CTCCGCGACG CCAGATTGAA GGTTCCTGTT GATTGATTTT
TCCTGTAAAT TTAGTACCAT TGGGGATTCT GTCTAGTCTG CTAGTTGGGG CGTGGAGGAA TTTCGGTGCT CCCGAGTTCT
TATCATCTGA TGCTTAGTGA TTCGGGTACA CGATGACACG ACAAATATGA TGATGCATCC TAGGATTTCT GTTAATCAGC
CGAAGGGGTC TACTGCCACA TAGGCGTTAG GTTAAGCAAA GGTGTGATTT TTGGATTGCT TGCGGGTGTT TTAATCCTAT
GGGATTGCTA GGTGGAGGTC TGAAGGAAAG GCACAATCTT GCCGTTACAA GTATGTAATC ATATGTGGTG ATTGGTGAAT
GGTGATGGCC TGATGGGTTA ACTTGGCCAA TTCTTTTTCA CTGTAGTTTC AGGGAATGCT GATGGTTAAA AACTTTTTGC
CCATGGCACT TCCACACTTT ATACTTACCC TTTATTCTCT CTCTCTAAAA CAACTGCTGT ACTTTCTCCT CTATTTGCAT
AATGGAGCTA CTGCCTATCA ATAATTAAAT TCTTAATTAG CATGGGAAGT ACTTTTTGCG ACTAAATATT TAATAAACAC
TCACCAGATT GTAAGATTTT AGTGCTTTGT TCCATGTCCA GAAGATAGAG GTGCATTTTA ATATTGGCGT TAGTTCTCAT
TCATTTGTTT GTCCTCATAT CAGTATGTGA TATGTTCTAC TATCTCATCT AAAATATATA TTTATCCTGC AAGTCAATGC
CAATTTATAT TTAATTTTCT TCGAAGAACG AAGACACAAG GTTCTTTTAC TGTGAAATTG AACTTTTCTT CCAAAATTGT
TAAATGTCAA TGTTACCATG CAGGTAGTAC CAAATGAAGT TCTACAAGTA GGGAATTCCC TGAGGATTCT GGATTTGACT
AACAATAAGA TAGGTATTTG GACTTTAGAC CATGACCCCT GGATACTTAG AAGTTCTGCA ATGCTAGTAT CAATATTTTC
TCTCTTTTTT TTTCTCATAT ATTGTCAGGA AGAAACTAGT TTGGAGTCGT TCATTGCTTC TTTCTTTCTT TTATTATGCA
CATCAGTATC AGATGGGAGG AAAAAAATTA TGCACACCCC TTTTTTTTCA CTTGGCATCA CTAACAAATG CATATACTTG
AAGCAAGTCA GCAACAATTC GACAAGTTAT TTTTTTTACC TTGCAGGGTT TCTTTGACAG TTTGGGTAGA AAAAAAATCC
AATTGAACTG CACACACTGT ATTTAGATGT TTCTATATCT TGAGAAATAT CAATTAAATA TATATTTTAT GTTGCAGCTG
AGATTCCCCA GGAAGTTGGC ACACTCGTGA ATATGCAAAG ACTTGTAAGA GTTAATGTTA ATAGAAATCA TGATTTGGTT
CATCTTACCA AGTTACTAGA GACATGTATT TTTAAGAGTG GTTCTTCTTT GCTTGACATT TAAGTTTACT ATTTCTTTTC
TGTTCCTGTA GGTTTTGGCT GGTAATTTGG TTGAAAGCAT CCCAGCTAAC ATTGGATATC TGCGGAATCT TAAAATCCTC
ACACTTGACA GAAATAAGAT CTCTGTCTTA CCTGAAGAAT GTTAGTTCAT AAAAACCTAA TGCTATCTTT ATTTATATGT
TTAGATAATA TTTATCATTT GTCCACGTGT ATATTCTTAA TCCTAGCAAC AAGTTAGTAG AGATTTATTG ACTTTTGCAA
TATTACACTT CACAATTTCC CACGTCTAAG TCCTAACTTG TTTCTTCCAT TCTATCCAGT GGGTTCTCTA TCAAATCTTC
AACAACTCTC TATTTCTCAG AATTCTTTAT CACGCCTGCC TAAGAGTGTA GGAGATTTGC GCAATGTAAG TTTCTTATTC
GATTCAAGAT GTTAAATTTT ATATATCTTT GAAAAGCAAC TTTTCTAGGC ACAAAATATT TTTTTGTCTT CTCAAAACTT
TTTTTTGGTA TAGCATGAAT GCCTTCAGAG TTACAAGCTG TTCCTTCTTT TTATTTTCCT CTTCAGAATC AAATAAACTC
TTGATTCTAT ATTTCCTCAT ATGAAATTTA CGCAGCTTGT TACATTCCGT AAAGTTTCTT CTTTACTAGT AAGTATTTTA
AACTTGTTTT AATAATGGAG ACTATGCTGT GCTCATCACT GTTTTTTCAA CCTTTTTTTT TTCCTGATGC AGATGTTGCT
ACTCAATGTA TCTGACAACA AACTAATTGC ACTTCCTGAA TCAATTGGAG GTTGCAGTTC CCTGGAAGAA TTGCAGGCAA
ATGGTAAGTC CATCAGTTTT TTGCAATGGT AGCATTTATA TCATTTCAAT TTTCTCTGCA CCCTGTTCAC ATGCATCCAT
GTTAATGCTA TACTGCTGCC ACACACACAC ACACACACAC ACACACAAAC ATGAGTGCTC TGTGCCGTCG TACTTTCCTA
TCTCGTATGC TATACCACCT GATATTCCAT TGGGAAAGGC ATGCCAGAAC CATTTTTAGA TACCTTTTGT CATCTAACTC
AAATATGATC CAACCATTCA TATGCTGTTT AAAAAAAAAA TGCAAAGCAC ATCGTGGTTT TCGTTTTCGA TGCATCATCT
TAGATAACCT TCACGAAAAC ATTTTCAGGA AATTCAATTG AAGACGTGCC TTCATCAATC TGTAACCTTG TTTGCCTCAA
ATCCCTATCA TTGAACGGGA ATAAGATTCG TCAGGTACGA ACTTATGAAT ATGCTTTTCC CTCGTCGATT ACTTCTGTGT
TTGAACCTGG AGGCTCTAGG GTCAAAGTCA GTGAATAATG ACTATTCATT TAGATTTGAA ATATCCTGGT TACATTGTTG
CCAACTTGTA ACGTACAAAA TAATAAGCAA AGATTCTCCG AACTTTGACT CTCCCTGACA GCTTCCCCAA AACCTACTGA
AAGACTGCAA GGCTCTTCAG AACATATCGT TGCATGACAA TCCAATCTCG ATGGACCAGT TTCAACAAGT TAGTGGCATG
AAAGCTTAAT ACAGATTCTT GTAATTTGAT TAATCTTGAT TCAATTATAA TTTGTTTTCT TTGTCTGTTG AAGATGGATG
GCTTTACGGA ATTTGAGGCA CGCCGAAGGA AAAAATTTGA CAAACAGATT GATTCAAATG TCATGATGAG TTCCACAGCA
CTGGATGAAG GCATTGATTT GAACTAGTTT TTCAGAAATT TTATTTAGTT TATAATTACC CCATTAGTCA AAAGACCAAC
TGTAAATCTA GTGTACATAT TAGTTTTTCC GATACTCTGA TTTGGTAAAA AGACAAAAAA ATGTATAACA CACACTAATG
AATGAACTGT GTAATTTTTG CAAATATTCA ATGAATTAGG TGTACATCAC CATCTTTGAT CTAC

Locus: Os03g0212200

Loading...

Locus: Os03g0212200

Loading...