Os03t0213700-01

Locus

Os03g0213700

Description

Protein of unknown function DUF647 domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RUS3

CGSNL Gene Name

ROOT UV-B SENSITIVE 3

Oryzabase Gene Symbol Synonym(s)

OsRUS3

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK067637 (DDBJ, Best hit)

Protein Evidence

B9F664 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Protein of unknown function DUF647 (IPR006968)

Full-length cDNA

J013109I22 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0213700-01)

Others

Oryzabase (21449)

Transcript

2622 bp

>Os03t0213700-01 Protein of unknown function DUF647 domain containing protein.
GTCTTGAGCTGAGCAGAAGCCCGCGACGTGCCCTGCACTGCACGCGGAAGCAGAGCTCCG
AGCCGTGGCGGCGGCGGGCGCGGGGCGGCGTCCGATCCAGATCCGCGCCGCCGGCGTGGG
CGGCCGGCTTACGAGGTGGTGGGCGACTGGTTGGCATCATGGACTCCTCCCGCTTCCGGA
GTGCGGCGGCCACGGAGGCGGCGGAGGAGGAGGCGGCGGGGTGGGTGACGGTCGAGGAGT
GGGCGGGCTCCTCCGCCGCCGCGCTCTCCCGCACCGCCGTCCTCACCGCCTCCCCCTCCT
CCTCCCTCGCCTCCCGCAGGTTCGGAAGCCGGTGGGGGCGGGTCGGCGGCCGGCTGCTCG
GCGCCTTCGTGCCCGAGGGCTTTCCTGGGAGCGTCACTCCGGATTACGTCCCGTTCCAGA
TGTGGGATACCTTGCAGGGTCTCTCGACTTACATCCGTGCAATGCTGTCTACTCAAGCTC
TTTTAGGCGCTATTGGAGTAGGTGAGAAATCTGCCACGGTTATAGGTGCCACTTTTCAGG
TAAATTTCGATTTCATGTCATGGTTTAGCCTTCTGCAGTTTTTCTTAGGAGCTAGGCATA
ACGTAAATGGTTTCTGATGAGCATATGTTAACTTCTTTTTGTGTCTTAAATTTGTGCATA
TATGAAATAGATTGCTTAGGTTGTTGTTTTCATTGCCCTGAGCTGCAGTCAGCTGGTAGT
AACTTGCTCTGCAGTCTAGTATGTGTTTTCCCCCCTCAATTTTCTTCTTTTATGGGCTTA
GTTTCAATTTCCTCATCATCTTTAATTACATGCTATTCTTGCAGTGGTTTCTCAGGGATT
TGACAGGAATGCTCGGTGGTATACTGTTCACTTTTTATCAGGTGTCAAATTCTCTTGCTA
ACTCGAATAGGCAATGCCATCTTATTGCCATTGATAGTTTGTTTACTGATGAGATAACTT
GCTTGGTCAGTATTTTATTTGTCTATAGGGTGTACTAATTCTTTGTGCTTTCACTTTTCC
CAGGGATCTAACCTTGATAGCAATGCTAAAATGTGGCGCCTAGTTGCAGACTTTATGAAT
GACCTTGGTAATATAGTCTATATCAGTAATCGCTGTATTAATTCTTTGAATGCGGGCGTC
TAATTTAAAGGTCCTGCAATCGTTTGGTATTTATATTCAAGACTAAGCATTCATTTTTCT
TTTGAGGTATTCTGCTATAGTAGGTGAATATTAAATAGCATATGTGTCACATGCCCCTGC
AAATGCATTTCACATGGAATCTGGATTTAAAAAATCCTTTGTTTAATGCGAATTCCTTGT
AGTATCAAAGTATGCTAGCAGAGTTTGTTTGTTGGTTTTGCAGGGATGTTGATGGATCTC
TTAAGCCCTCTGTTTCCTTCATCATTGATTGTTATAATGTGTTTAGGCAGCCTATCTCGA
TCCTTCACTGGTGTTGCTAGTGGAGCAACTAGAGCAGCGTTAACCCAGCATTTTGCACTT
GCCAATAATGCAGCTGATATATCTGCAAAGCTGCAGAAGCATACTCAACTTTTCAGGAGG
GCAGTCAGGAGACACTTGCAACAATGTTAGGAATGGGACTGGGAATGCTTCTTGCCCATG
TTACCAGAGGGCATGCTTTGGGTGTATGGGTTTCATTCCTTTCTCTAACGATATTCCATA
TGTATGCAAATTACAAGGCAGTGCAGTCACTTTCACTCACAACACTAAATTATGAGAGAA
GTTCCATCCTGCTGCAGTACTTCATGGACAATGGTGAAGTCCTCACACCACAACAGGTTT
CCAAGCAAGAGCATATTCTTCCATATTGGTCAAGCTGGCGGAAATTTCTTAGAATTAAAC
TGCCACATGAGCATGTACATTTAGGTGCTAAAGCCTCAAGGCTTACACACCCTGATTTGT
AAGTACTAAGTTTTGAGTTATGCTTTTATGTGTTTATCACTCTATGGGGGAAGAAACATT
TACTCTGTTTGTCAAATTTGATAGGCTGCAGATTGCAAAAACAAGGCCCTACTATAGAAA
TGGTATAACTCGTCTCTTGGTTAATGTAACACTAAACTAACTGTTGCTGACTTTTCTTTT
ACTTCACAAATCTATTCAGAGAACTATTTCTTGCTGGATAAGGAAGGCAGTGTTCACATT
TTCATCCACAAGCAGGCAGCGGCAACAGATATTTTGATGTCCTTCATACATGGACTCGTG
TTAGCACATTTGATGCAGAAGAGCAAATCTGGGCATGCGGAGGCTCGCCAATGGATTGAT
GAGAAATATAACACTTTTATCTCAAAGTTGCAAGTTGAAGGTTACTCAACAGAGCGACTT
CTTTCACACTCGATCGTGTGGAGGGCACATTGGGTTCATGGTCCCTCTGAAGAGAAGCTC
GAGTAGGAGGAAGCAGGCGAAGGTAGCAGTATCTGTTCAACGCGATATTATTAGAGCAAT
TCGACATACTGCATAGGATGCTTTGCATATCTCGTTTGTTTCCGTTCCGAATTGCCACTT
TTCACCATGGAGTTGCACTGCATCTTGTAATCGCATGGGATATACTTTAAAAGCTATACT
TGATAATAATACTATTAAATGATATAGCAAATGGTTTCGTTG

CDS

459 bp

>Os03t0213700-01 Protein of unknown function DUF647 domain containing protein.
ATGGACTCCTCCCGCTTCCGGAGTGCGGCGGCCACGGAGGCGGCGGAGGAGGAGGCGGCG
GGGTGGGTGACGGTCGAGGAGTGGGCGGGCTCCTCCGCCGCCGCGCTCTCCCGCACCGCC
GTCCTCACCGCCTCCCCCTCCTCCTCCCTCGCCTCCCGCAGGTTCGGAAGCCGGTGGGGG
CGGGTCGGCGGCCGGCTGCTCGGCGCCTTCGTGCCCGAGGGCTTTCCTGGGAGCGTCACT
CCGGATTACGTCCCGTTCCAGATGTGGGATACCTTGCAGGGTCTCTCGACTTACATCCGT
GCAATGCTGTCTACTCAAGCTCTTTTAGGCGCTATTGGAGTAGGTGAGAAATCTGCCACG
GTTATAGGTGCCACTTTTCAGGTAAATTTCGATTTCATGTCATGGTTTAGCCTTCTGCAG
TTTTTCTTAGGAGCTAGGCATAACGTAAATGGTTTCTGA

Protein

153 aa

>Os03t0213700-01 Protein of unknown function DUF647 domain containing protein.
MDSSRFRSAAATEAAEEEAAGWVTVEEWAGSSAAALSRTAVLTASPSSSLASRRFGSRWG
RVGGRLLGAFVPEGFPGSVTPDYVPFQMWDTLQGLSTYIRAMLSTQALLGAIGVGEKSAT
VIGATFQVNFDFMSWFSLLQFFLGARHNVNGF*

5'UTR

chr03:5960375..5960532 (- strand) : 158 bp

CDS

chr03:5960214..5960374 (- strand) : 161 bp

chr03:5960073..5960130 (- strand) : 58 bp

chr03:5959632..5959691 (- strand) : 60 bp

chr03:5959474..5959512 (- strand) : 39 bp

chr03:5959229..5959369 (- strand) : 141 bp

3'UTR

chr03:5958399..5959228 (- strand) : 830 bp

chr03:5958226..5958308 (- strand) : 83 bp

chr03:5958005..5958160 (- strand) : 156 bp

chr03:5957391..5957483 (- strand) : 93 bp

chr03:5956388..5956915 (- strand) : 528 bp

chr03:5955407..5955721 (- strand) : 315 bp

FASTA

>Os03t0213700-01 class=Sequence position=chr03:5955407..5960532 (- strand)
GTCTTGAGCT GAGCAGAAGC CCGCGACGTG CCCTGCACTG CACGCGGAAG CAGAGCTCCG AGCCGTGGCG GCGGCGGGCG
CGGGGCGGCG TCCGATCCAG ATCCGCGCCG CCGGCGTGGG CGGCCGGCTT ACGAGGTGGT GGGCGACTGG TTGGCATCAT
GGACTCCTCC CGCTTCCGGA GTGCGGCGGC CACGGAGGCG GCGGAGGAGG AGGCGGCGGG GTGGGTGACG GTCGAGGAGT
GGGCGGGCTC CTCCGCCGCC GCGCTCTCCC GCACCGCCGT CCTCACCGCC TCCCCCTCCT CCTCCCTCGC CTCCCGCAGG
TGAACCCCCG TTCCTCCTCC CTCGGATCCG CTTTGCCCCC GCTCACCCAT CTCACCCCGC GACGCGGCGG CGGCGCGCGC
AGGTTCGGAA GCCGGTGGGG GCGGGTCGGC GGCCGGCTGC TCGGCGCCTT CGTGCCCGAG GTGAGTGAGT CGCCGTGGTT
GTGCGCATCG CCTCGCACGC GGAATCGTTG CTCTCGTTTC TCGCCCCTGC TATAACACTC GCACAGATGC AATGCAATGC
AAACACCCTC GAGGAATTGA TCATGTTCAA CTACTACTAC TACTACTACT ACTACTACTA CTACTACTAC TACTACTACT
ACTACTACTA CTACTACTAC TACTACTACC AACACGCGAC TTGATTGATT GCTTTGTCCT CTTCGTGTCA ATGGCGACCA
TGGGCAAAGC ATGTGATTAA GGCCGGTGTC TGATGGAATT TACTGCCGTG GAGTCTTCTC CATTTTCACA CTTTGAAAAT
TGTTGGTAAC TCACGAGCGA GAGCTGCCTC TCTGTCTGCA GGGCTTTCCT GGGAGCGTCA CTCCGGATTA CGTCCCGTTC
CAGATGTGGG ATACCTTGCA GGTGAATTTT TTTTCTTGTG GCAATGAACT GTGTGTCACA ATGTCTATTA CCTTCGTTTT
TAATAACTGC TTTGGGCTAA GTTCTTAGCC AAGTTGGTAT TATGCTTTGC TTATTTGCAG GGTCTCTCGA CTTACATCCG
TGCAATGCTG TCTACTCAAG TAAGCTTGAC GCTGCCCAAT CTTCGCTCAT CTTGCACTCA TGTCCTGTCA TATTTTGCAC
TGTTCTAGAT GGAATGCCAT ATTAATTTTT GAATGGACTC CAGGCTCTTT TAGGCGCTAT TGGAGTAGGT GAGAAATCTG
CCACGGTTAT AGGTGCCACT TTTCAGGTAA ATTTCGATTT CATGTCATGG TTTAGCCTTC TGCAGTTTTT CTTAGGAGCT
AGGCATAACG TAAATGGTTT CTGATGAGCA TATGTTAACT TCTTTTTGTG TCTTAAATTT GTGCATATAT GAAATAGATT
GCTTAGGTTG TTGTTTTCAT TGCCCTGAGC TGCAGTCAGC TGGTAGTAAC TTGCTCTGCA GTCTAGTATG TGTTTTCCCC
CCTCAATTTT CTTCTTTTAT GGGCTTAGTT TCAATTTCCT CATCATCTTT AATTACATGC TATTCTTGCA GTGGTTTCTC
AGGGATTTGA CAGGAATGCT CGGTGGTATA CTGTTCACTT TTTATCAGGT GTCAAATTCT CTTGCTAACT CGAATAGGCA
ATGCCATCTT ATTGCCATTG ATAGTTTGTT TACTGATGAG ATAACTTGCT TGGTCAGTAT TTTATTTGTC TATAGGGTGT
ACTAATTCTT TGTGCTTTCA CTTTTCCCAG GGATCTAACC TTGATAGCAA TGCTAAAATG TGGCGCCTAG TTGCAGACTT
TATGAATGAC CTTGGTAATA TAGTCTATAT CAGTAATCGC TGTATTAATT CTTTGAATGC GGGCGTCTAA TTTAAAGGTC
CTGCAATCGT TTGGTATTTA TATTCAAGAC TAAGCATTCA TTTTTCTTTT GAGGTATTCT GCTATAGTAG GTGAATATTA
AATAGCATAT GTGTCACATG CCCCTGCAAA TGCATTTCAC ATGGAATCTG GATTTAAAAA ATCCTTTGTT TAATGCGAAT
TCCTTGTAGT ATCAAAGTAT GCTAGCAGAG TTTGTTTGTT GGTTTTGCAG GGATGTTGAT GGATCTCTTA AGCCCTCTGT
TTCCTTCATC ATTGATTGTT ATAATGTGTT TAGGCAGCCT ATCTCGATCC TTCAGTAAGC GGATTTACAT GATGAATTTC
ATAACCTTTT AAATTTTCTT TTAAAATGTT TGTTCGTTAA CTAATTATTT GACTATCTGT ATAGCTGGTG TTGCTAGTGG
AGCAACTAGA GCAGCGTTAA CCCAGCATTT TGCACTTGCC AATAATGCAG CTGATATATC TGCAAAGGTA ACTTTGCATT
ATCTTGTAAC ATCCTAAATG CCAATTAGAT GGTAAATTTC TCTAAACTGT AGCTGCAGAA GCATACTCAA CTTTTCAGGA
GGGCAGTCAG GAGACACTTG CAACAATGTT AGGAATGGGA CTGGGAATGC TTCTTGCCCA TGTTACCAGA GGGCATGCTT
TGGGTGTATG GGTTTCATTC CTTTCTCTAA CGATATTCCA TATGTATGGT GAGTGCATCA TTCCAATATT TATTTATTTA
TTTTTTGTAA GAAGGCCTTT ATAATTGAAG AATATTATTC AATTATGAGG TCAGAGGAAT ATGAACAAAA GGTGTGTAGA
TAAGTTTTTC CATCAGGACA CTGCCACAAA AACACAAATG AATTGTGAAA CAAATATGGT ACACATGAAT AACATGAAGA
AAGCAGTTAT AACAAGAATG CTGCATACAT GGATTTCCTA TCGAAATTTT CTATGGATTC TGGCAGTTTA AGGTATCCAG
AGATTCAGAC GTGGCACTAA TCTGGATTTA GCTAAACTAG ATAATTTTTA TCTGGATCCC GAGTCCTAAC CTCCTTTCTG
GTCCATACCA ACTTTTCACT AAATAAGTTT TGTTCTTTTC CTACTTTGTT CTTAGGAATA GGTTAGTTTG AAACCTCATT
TTTCTACTTT GTACTAGATA ATTTGAAGCA CCACCGAGTA TTTGCAGGAA CTCTTCTATT TACATCTTGT TTTATTTGGG
ACTATTCAGC AAATTACAAG GCAGTGCAGT CACTTTCACT CACAACACTA AATTATGAGA GAAGTTCCAT CCTGCTGCAG
TACTTCATGG ACAATGGTGA AGGTGAGTAC ACTATTTTCC TTTTCATGGT ATCATGAAAT TCATGCTCTT GCGATCACTA
TTGCATGCGA AAAAAGCTAA TGAGCCCTGG AAAGTGTTAG TAGCTTGAAG AGGATGTAAA TATATTTTAC TGTAATAGTG
TTTGTATATC ATCAGCGGCT TAATGCTATG TGCTTTGTGC CCATTATTTT CTTCTATATC AATAAAAGCC CAAGCTTGGT
CAGCTTGTGG TTAGCAGGCC ATTACTAGAT GCACCTAACA TATTGTAACA AATTTCAAGT ATAATGTGTA CTGCACTCTG
AAAACGTCCT GCTTCTCTAT TTTATCATGA ATTCATGTGT TGATGTTGAA CTATTCACGG CATATGAAAT CATTTCCTTA
ACAATAGCTT TTGCTGCTTC ATCTGTGTGA ATAAAAATTC CATGGCAAGC CATTACATTA TTTAATCATC AAAATTTCTT
GGGTGGAATT TTCCTAGTCC TCACACCACA ACAGGTTTCC AAGCAAGAGC ATATTCTTCC ATATTGGTCA AGCTGGCGGA
AATTTCTTAG AATTAAACTG CCACATGAGC ATGTACATTT AGGTGCTAAA GCCTCAAGGC TTACACACCC TGATTTGTAA
GTACTAAGTT TTGAGTTATG CTTTTATGTG TTTATCACTC TATGGGGGAA GAAACATTTA CTCTGTTTGT CAAATTTGAT
AGGCTGCAGA TTGCAAAAAC AAGGCCCTAC TATAGAAATG GTATAACTCG TCTCTTGGTT AATGTAACAC TAAACTAACT
GTTGCTGACT TTTCTTTTAC TTCACAAATC TATTCAGAGA ACTATTTCTT GCTGGATAAG GAAGGCAGTG TTCACATTTT
CATCCACAAG CAGGCAGCGG CAACAGATAT TTTGATGTCC TTCATACATG GACTCGTGTT AGCACATTTG ATGCAGAAGA
GCAAATCTGG GCATGCGGAG GCTCGCCAAT GGATTGATGA GAAATATAAC ACTTTTATCT CAAAGGTAAA GCCCTATACC
ATAGAATATA GATGTTCATG TTGCGTTTGA CTTGCTACGA CATTAACTGA TGTTAGTTTA TCCTTTAACT GATGTTAGTT
TATCCTCTCA GCGTTTCTTA ATTTGTATTC ACATACAATT GGTGGTAATT CATGCAAGGC CAAAATCTTT AAAGAACCAT
CTCTCTGAGC TCTGAGCTTA TATTCGTAGA ATGAACACAC AGTTGTAAAT GCCTTCTTCT ATATCATTAA TGGTAGGGTT
GTGGAGATGT ACTATACTCC CTGACTGTCT GTTACAGCTA ATGAAAAATG AGGATTCCAC GCATTTGCCT GTTGTATATG
ACACCAAACT GCGGTGGGAG AAGTCAGATC CATAAAGTTA AGGAATGCTC TATTTTGGGT ATGTCAAAAA CCAAAAGCTG
AGTCATCGTA ACACTGGTTT TCGCCTTAGC ATGGCTACCC CAAAATGGCG TATATCCCCA TCGCAGATAG CAGTATAGCA
CCATCTTATG CACGTGTGCT GGAGTACATT CAGGTCTCTT AGTAGCCTGG TCCTTGTACT TTGTCAAAGG GTGGATTTAG
GTCTGGTAAC ATTTTATGAT ATAAATGTGA ATTTCAACGT TTTTGCAGTT GTCTTCTACT GATGATGATT AATTTTCTCC
CCTTTGCGCA GTTGCAAGTT GAAGGTTACT CAACAGAGCG ACTTCTTTCA CACTCGATCG TGTGGAGGGC ACATTGGGTT
CATGGTCCCT CTGAAGAGAA GCTCGAGTAG GAGGAAGCAG GCGAAGGTAG CAGTATCTGT TCAACGCGAT ATTATTAGAG
CAATTCGACA TACTGCATAG GATGCTTTGC ATATCTCGTT TGTTTCCGTT CCGAATTGCC ACTTTTCACC ATGGAGTTGC
ACTGCATCTT GTAATCGCAT GGGATATACT TTAAAAGCTA TACTTGATAA TAATACTATT AAATGATATA GCAAATGGTT
TCGTTG

Locus: Os03g0213700

Loading...

Locus: Os03g0213700

Loading...