Os03t0214600-01

Locus

Os03g0214600

Description

Similar to 26S proteasome subunit-like protein (26S proteasome subunit RPN9a).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RPN9B

CGSNL Gene Name

19S REGULATORY PARTICLE NON-ATPASE SUBUNIT 9B

Oryzabase Gene Symbol Synonym(s)

OsRpn9b, Rpn9b

Oryzabase Gene Name Synonym(s)

19S regulatory particle non-ATPase subunit 9b, RP non-ATPase 9b

Transcript Evidence

AK101240 (DDBJ, Best hit)

AK064850 (DDBJ, Best hit)

AK068605 (DDBJ, Best hit)

Protein Evidence

NP_001152194.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Proteasome component (PCI) domain (IPR000717)

Full-length cDNA

J033031O16 (Online Clone Ordering)

J013000H02 (Online Clone Ordering)

J013157F16 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0214600-01)

Others

Oryzabase (20569)

Transcript

1576 bp

>Os03t0214600-01 Similar to 26S proteasome subunit-like protein (26S proteasome subunit RPN9a).
TTTGTTGTTCGCCTCCGCTCGCCGCGCCTGCAGATCCCCCTCTCGCCTCCTCTCCTCTCC
TCCCCAAACCCTAGCGAGCGACCAACTCCTGGGTGGGGGGATTTTTCTCCATGGCGCTGC
AGTTCGTCGAGTCGCAGCGCGAGGCGCGGCCGGAGCTCGCCGACCCGTACGCCGACCTCG
CCGACCTCTACCAGCGGAAGCTCTGGCACCAGCTCACCCTCAAGCTCGACCACTTCCTCC
AGCTCCCTGCCGCGCAGACGGGTGACACCCTCATACAGCTCTACAACAATTTCATCACTG
ATTTCGAGACGAAGATCAATCTTCTCAAACTTGCGCATTTCGCGGTCATCGCTTCGCGCC
AGTACCCCGACAAGGATGCTGCTATAAGTTTCCTCGAGGGGGTAATCACAAAATTGCGCG
AGACAAAGGACCTGCGCATCAATGAACCCATTCTCTACGTCAAGATGCAAATCGCTGCGA
TTAACCTGGAGAAGGGAAATCAGAAGGAGTGCAAGAAACTTTTGGACGAAGGAAAATCTA
CTCTAGATAGCATGACTGATGTTGATCCCACAGTTCATGCTAGCCTCTACTGGATATCAT
CTCAGTACCATAAGGCTCGCCAAGAATTTGCTGAGTTCTACAAGAATGCCCTTCTGTATC
TGGCTTACACTACTGTAGAGTCACTCTCTGAGTCTTTCAAACTGGATTTGGCATTTGATC
TCTCCCTTGCAGCCTTGCTTGGTGATAACATCTACAACTTTGGGGAATTGTTAGCTCACC
CGATTATCAACAGTCTTATTGGAACCAAGGTGGAGTGGGTCTATCATATGTTACAAGCAT
TCAACACCGGCAACCTAGCTCTCTACCAAGAACTATGTAGGGTCCACAATGCTGCTCTCA
GTGCTCAGCCAGCTTTGGTGCAGAATGAACGGAAACTGCTAGAGAAGATCAACATTCTAT
GTCTGATGGAGATAATCTTTAGCCGGGCGTCAGAAGACAGAACTATCCCATTAAGTGTTA
TAGCCGAGCGCACTAAGCTTTCTATCAGTGATGTGGAATATCTTCTTATGAAGAGCCTCT
CGGTTCATCTTATAGAGGGGATAATTGATGAGGTGGACAGCACAGTTCACGTGTCATGGG
TCCAGCCTAGAGTACTTGGAATTCCACAGGTGAAGGCGTTGCGCGAGCGGTTGGACGCCT
GGGTTGGAAAAGTGCATACCACCCTGTTGTCCGTTGAGGCAGAGACGCCTGATCTTGTAG
CTGCATAACTTATCCAACCTTCCTTTTGCTATATGGCCTTGGTCACCAAGGGTGCGGTGC
GAAAAGAGAGATGATCTGGCTGTGGTGGCTGTAGTTTTCTGGGTGATGAAAACATGTTGC
CTTGAACGTTTCCCTGGCACCCTATTGATCAGGACCTGTAATTTCATTTCTCTTTAAATC
CTCTGGACGTTGAGGCCTGGAGCTTGATGCATTGATCACGGAAAAAGCACAAGCGGATCA
AAAGTTTCATACCAGTAGGGTGTCATTGTAGTTCTTTTCCCAGTGTGATTTAGATTGTTA
CTCAGCGGGTATTTTC

CDS

1158 bp

>Os03t0214600-01 Similar to 26S proteasome subunit-like protein (26S proteasome subunit RPN9a).
ATGGCGCTGCAGTTCGTCGAGTCGCAGCGCGAGGCGCGGCCGGAGCTCGCCGACCCGTAC
GCCGACCTCGCCGACCTCTACCAGCGGAAGCTCTGGCACCAGCTCACCCTCAAGCTCGAC
CACTTCCTCCAGCTCCCTGCCGCGCAGACGGGTGACACCCTCATACAGCTCTACAACAAT
TTCATCACTGATTTCGAGACGAAGATCAATCTTCTCAAACTTGCGCATTTCGCGGTCATC
GCTTCGCGCCAGTACCCCGACAAGGATGCTGCTATAAGTTTCCTCGAGGGGGTAATCACA
AAATTGCGCGAGACAAAGGACCTGCGCATCAATGAACCCATTCTCTACGTCAAGATGCAA
ATCGCTGCGATTAACCTGGAGAAGGGAAATCAGAAGGAGTGCAAGAAACTTTTGGACGAA
GGAAAATCTACTCTAGATAGCATGACTGATGTTGATCCCACAGTTCATGCTAGCCTCTAC
TGGATATCATCTCAGTACCATAAGGCTCGCCAAGAATTTGCTGAGTTCTACAAGAATGCC
CTTCTGTATCTGGCTTACACTACTGTAGAGTCACTCTCTGAGTCTTTCAAACTGGATTTG
GCATTTGATCTCTCCCTTGCAGCCTTGCTTGGTGATAACATCTACAACTTTGGGGAATTG
TTAGCTCACCCGATTATCAACAGTCTTATTGGAACCAAGGTGGAGTGGGTCTATCATATG
TTACAAGCATTCAACACCGGCAACCTAGCTCTCTACCAAGAACTATGTAGGGTCCACAAT
GCTGCTCTCAGTGCTCAGCCAGCTTTGGTGCAGAATGAACGGAAACTGCTAGAGAAGATC
AACATTCTATGTCTGATGGAGATAATCTTTAGCCGGGCGTCAGAAGACAGAACTATCCCA
TTAAGTGTTATAGCCGAGCGCACTAAGCTTTCTATCAGTGATGTGGAATATCTTCTTATG
AAGAGCCTCTCGGTTCATCTTATAGAGGGGATAATTGATGAGGTGGACAGCACAGTTCAC
GTGTCATGGGTCCAGCCTAGAGTACTTGGAATTCCACAGGTGAAGGCGTTGCGCGAGCGG
TTGGACGCCTGGGTTGGAAAAGTGCATACCACCCTGTTGTCCGTTGAGGCAGAGACGCCT
GATCTTGTAGCTGCATAA

Protein

386 aa

>Os03t0214600-01 Similar to 26S proteasome subunit-like protein (26S proteasome subunit RPN9a).
MALQFVESQREARPELADPYADLADLYQRKLWHQLTLKLDHFLQLPAAQTGDTLIQLYNN
FITDFETKINLLKLAHFAVIASRQYPDKDAAISFLEGVITKLRETKDLRINEPILYVKMQ
IAAINLEKGNQKECKKLLDEGKSTLDSMTDVDPTVHASLYWISSQYHKARQEFAEFYKNA
LLYLAYTTVESLSESFKLDLAFDLSLAALLGDNIYNFGELLAHPIINSLIGTKVEWVYHM
LQAFNTGNLALYQELCRVHNAALSAQPALVQNERKLLEKINILCLMEIIFSRASEDRTIP
LSVIAERTKLSISDVEYLLMKSLSVHLIEGIIDEVDSTVHVSWVQPRVLGIPQVKALRER
LDAWVGKVHTTLLSVEAETPDLVAA*

5'UTR

chr03:5999908..6000017 (+ strand) : 110 bp

CDS

chr03:6000018..6000164 (+ strand) : 147 bp

chr03:6000712..6001158 (+ strand) : 447 bp

chr03:6001272..6001352 (+ strand) : 81 bp

chr03:6002058..6002254 (+ strand) : 197 bp

chr03:6002350..6002449 (+ strand) : 100 bp

chr03:6003182..6003367 (+ strand) : 186 bp

3'UTR

chr03:6003368..6003675 (+ strand) : 308 bp

FASTA

>Os03t0214600-01 class=Sequence position=chr03:5999908..6003675 (+ strand)
TTTGTTGTTC GCCTCCGCTC GCCGCGCCTG CAGATCCCCC TCTCGCCTCC TCTCCTCTCC TCCCCAAACC CTAGCGAGCG
ACCAACTCCT GGGTGGGGGG ATTTTTCTCC ATGGCGCTGC AGTTCGTCGA GTCGCAGCGC GAGGCGCGGC CGGAGCTCGC
CGACCCGTAC GCCGACCTCG CCGACCTCTA CCAGCGGAAG CTCTGGCACC AGCTCACCCT CAAGCTCGAC CACTTCCTCC
AGCTCCCTGC CGCGCAGGTT TCCCACCACC TCCTCCCCTC ACCCTCTCTT GCAAGCGCCT TCTTGTTCTT GGTTAGGTTA
GCTGCTGTCC CCCCCGTACG GATCTCGCCG CAAACCCTAC CCACCGTGCC TAGTTCGATT TGAACCCTAG TTGGACTGGA
TGGGCCCTAA ATTCGATACC GATCCGGCCG CAAACAGGCC GCCACTTTGT GGAGATTTAA ACCTCATGTT TCAACCTTGA
AAAGTACATA TGAACATTCG AAGATAAATA TTTGGGTTTC ATTACTTGCA TATGAAATAT TTAAAGATCA GATTTCACTA
CCTGGAAATT GAGGTACCAG GGAATAAGCT Gtggtccaaa gcgcaaaaga ttttaattat atgtgatgtt atgtgaaagg
ataagcctta accctagtcc attactctgt tgtgaaatat tggttgataa agatgcccaa agtgaaattt actctTGTTG
TTTGAACCTT GCTTAGGTTT GTAACTGCTG TGTTGTGCCT TCTGCGTTTT TGCAATTCTA ACAGCGGCAT CCATTCTCCT
ACAGACGGGT GACACCCTCA TACAGCTCTA CAACAATTTC ATCACTGATT TCGAGACGAA GATCAATCTT CTCAAACTTG
CGCATTTCGC GGTCATCGCT TCGCGCCAGT ACCCCGACAA GGATGCTGCT ATAAGTTTCC TCGAGGGGGT AATCACAAAA
TTGCGCGAGA CAAAGGACCT GCGCATCAAT GAACCCATTC TCTACGTCAA GATGCAAATC GCTGCGATTA ACCTGGAGAA
GGGAAATCAG AAGGAGTGCA AGAAACTTTT GGACGAAGGA AAATCTACTC TAGATAGCAT GACTGATGTT GATCCCACAG
TTCATGCTAG CCTCTACTGG ATATCATCTC AGTACCATAA GGCTCGCCAA GAATTTGCTG AGTTCTACAA GAATGCCCTT
CTGTATCTGG CTTACACTAC TGTAGAGTCA CTCTCTGAGT CTTTCAAACT GGTATGTTCT ATTGTTAACA ATGCAATTAC
ATGACAAAAA ATCATTTCCT CCTCGCATTA TTTTAATAAT GTATCTTGCA TCTATGTTTA CCCTTTGATG CTGTCTTGTG
TCAGGATTTG GCATTTGATC TCTCCCTTGC AGCCTTGCTT GGTGATAACA TCTACAACTT TGGGGAATTG TTAGCTCACC
CGATTGTAAG TTGGACTTTG CTTACGCATG ATTTCTTTTG TTGCCACTAG TTAGTAGTAC CACCTTTGTT TTATCCATAC
TTTTTTGTGT TTCTTGATTG CTTGATTAAA ATTAACTCTG CTTGCCTATA TAAACATTAC ATGTGGCTTT TCTTGGTACT
CACAACTGCC AGTTCTGATA ATTATTTATT AGTTGTTTTT ATCTGATGCT TGCTAGAACT GCAAGGCGTC CAAGGTACCT
GTGTATGTTA TGGTAGTTAA GTTTCGGAGT TTTGTACACA GTAACTTACA TCTATTGCCA AATCGGTAGC AGAAATTTCA
TGAGTTGAAT GTATGCAGTT AACATTGACA CAATAAAATG CTACCGATTG TGTAAAGCAT ATCAAAATGA TGAAATATCC
TATGCCTGAT CCTTTTTTGC TGAATGTTGA ATGATGTAAT TGTGAACCAC TATATTATAA TTATGTAAAC TTCGTATTTT
CTTGAATTGA AATAGCATAA ACTTAAGTTT GCATGAATTA ATGGCAAACC ATCTTTTTTG TGCATGGAAA AATCAATATT
GACTTGTGGA TACCAAACAA AAAAATTCCA GACACAAGGT AGCCTTTATG GGATTGAAAT ATTGAATGGC CCCTAAATCT
ATATATCGGC ATATATGGTT GTCATTTGGT ACATCTCTGT CTGAAGTTGT TTATATTTTT ATATCCTTAG ATCAACAGTC
TTATTGGAAC CAAGGTGGAG TGGGTCTATC ATATGTTACA AGCATTCAAC ACCGGCAACC TAGCTCTCTA CCAAGAACTA
TGTAGGGTCC ACAATGCTGC TCTCAGTGCT CAGCCAGCTT TGGTGCAGAA TGAACGGAAA CTGCTAGAGA AGATCAACAT
TCTATGTCTG ATGGAGATAA TCTTTAGGTA CAACTTTGCT ACTTGCTTTT CTATGCCACC ACAAATGTCT TGCCCCTTTT
CCTTTATTCC TTCTAAGCCC TGTGTTCTTT TTCATGTTGT AGCCGGGCGT CAGAAGACAG AACTATCCCA TTAAGTGTTA
TAGCCGAGCG CACTAAGCTT TCTATCAGTG ATGTGGAATA TCTTCTTATG AAGAGCCTCT CGGTAATTGC ATTTCTTACA
TTCGATCTTT CATAAGATAT TATTTGCAAT ATGCCAATAT CATGTTAATT CATTGTTGGG ATAGACAATG CATGAATGCC
ATTCATAAAC ATCTAGTTTT GTTGTGCATA AATTGTTTTT TAAGATTAGA CATTAGAATG CTTCTAATGC TTCTGTCATT
TTAATGTGGC AGCTGTATAT GGATAGTGAT TATTTGATAA TTACTGCCTT CAATTCCTCC CCTTTGTGAA CTTGTCTTTT
TTTTTAATTG CTGATGGTTT GTTTTGTGAA TCTTTAGTTG TGAGTTATGG GTGTGCGTTG TCAGTTAAAC TAGACATGTG
ATTCATATAT TTGTGTTTGT TGATCACAGC AAACCTGTGT CTCTCCTTGT TACATGCTAC TATTGCTTTT ACCTTATACG
GCTTCAGTGT TTGCACAATG TATCAACTAG TATTCCTAGT TGATGTTCTC ATCTTTTTCT TCCATTACAG TTCTTTTCTA
CATCAGTTAG TACATTATAG TATATAATAA TGCTGCCCCT GAAAGGCAGA ATATATAGGT AGCCAAGATA GAATGCCACT
GCTATCAGCT TCTTACAAAA GCTCCATGCT GATGTTTTCT ATTTAGTTGC TAATGGAGCC TGGGTGCTGT ATTTCCATGA
GGCCATCAAT TGCCATACAA TTTAAAAGTA AATTGGAATA TGAGAGAATT ATTAATGATT CCCCCATTTT GCAGGTTCAT
CTTATAGAGG GGATAATTGA TGAGGTGGAC AGCACAGTTC ACGTGTCATG GGTCCAGCCT AGAGTACTTG GAATTCCACA
GGTGAAGGCG TTGCGCGAGC GGTTGGACGC CTGGGTTGGA AAAGTGCATA CCACCCTGTT GTCCGTTGAG GCAGAGACGC
CTGATCTTGT AGCTGCATAA CTTATCCAAC CTTCCTTTTG CTATATGGCC TTGGTCACCA AGGGTGCGGT GCGAAAAGAG
AGATGATCTG GCTGTGGTGG CTGTAGTTTT CTGGGTGATG AAAACATGTT GCCTTGAACG TTTCCCTGGC ACCCTATTGA
TCAGGACCTG TAATTTCATT TCTCTTTAAA TCCTCTGGAC GTTGAGGCCT GGAGCTTGAT GCATTGATCA CGGAAAAAGC
ACAAGCGGAT CAAAAGTTTC ATACCAGTAG GGTGTCATTG TAGTTCTTTT CCCAGTGTGA TTTAGATTGT TACTCAGCGG
GTATTTTC

Locus: Os03g0214600

Loading...

Locus: Os03g0214600

Loading...