Os03t0214600-02

Locus

Os03g0214600

Description

Similar to 26S proteasome non-ATPase regulatory subunit 13.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RPN9B

CGSNL Gene Name

19S REGULATORY PARTICLE NON-ATPASE SUBUNIT 9B

Oryzabase Gene Symbol Synonym(s)

OsRpn9b, Rpn9b

Oryzabase Gene Name Synonym(s)

19S regulatory particle non-ATPase subunit 9b, RP non-ATPase 9b

Transcript Evidence

AK061942 (DDBJ, Best hit)

Protein Evidence

NP_001152194.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Proteasome component (PCI) domain (IPR000717)

Full-length cDNA

001-042-D11 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0214600-02)

RiceXPro (AK061942)

Others

Oryzabase (20569)

KEGG (Os03t0214600-02)

Transcript

1390 bp

>Os03t0214600-02 Similar to 26S proteasome non-ATPase regulatory subunit 13.
TCTACAACAATTTCATCACTGATTTCGAGACGAAGATCAATCTTCTCAAACTTGCGCATT
TCGCGGTCATCGCTTCGCGCCAGTACCCCGACAAGGATGCTGCTATAAGTTTCCTCGAGG
GGGTAATCACAAAATTGCGCGAGACAAAGGACCTGCGCATCAATGAACCCATTCTCTACG
TCAAGATGCAAATCGCTGCGATTAACCTGGAGAAGGGAAATCAGAAGGAGTGCAAGAAAC
TTTTGGACGAAGGAAAATCTACTCTAGATAGCATGACTGATGTTGATCCCACAGTTCATG
CTAGCCTCTACTGGATATCATCTCAGTACCATAAGGCTCGCCAAGAATTTGCTGAGTTCT
ACAAGAATGCCCTTCTGTATCTGGCTTACACTACTGTAGAGTCACTCTCTGAGTCTTTCA
AACTGGATTTGGCATTTGATCTCTCCCTTGCAGCCTTGCTTGGTGATAACATCTACAACT
TTGGGGAATTGTTAGCTCACCCGATTATCAACAGTCTTATTGGAACCAAGGTGGAGTGGG
TCTATCATATGTTACAAGCATTCAACACCGGCAACCTAGCTCTCTACCAAGAACTATGTA
GGGTCCACAATGCTGCTCTCAGTGCTCAGCCAGCTTTGGTGCAGAATGAACGGAAACTGC
TAGAGAAGATCAACATTCTATGTCTGATGGAGATAATCTTTAGCCGGGCGTCAGAAGACA
GAACTATCCCATTAAGTGTTATAGCCGAGCGCACTAAGCTTTCTATCAGTGATGTGGAAT
ATCTTCTTATGAAGAGCCTCTCGGTTCATCTTATAGAGGGGATAATTGATGAGGTGGACA
GCACAGTTCACGTGTCATGGGTCCAGCCTAGAGTACTTGGAATTCCACAGGTGAAGGCGT
TGCGCGAGCGGTTGGACGCCTGGGTTGGAAAAGTGCATACCACCCTGTTGTCCGTTGAGG
CAGAGACGCCTGATCTTGTAGCTGCATAACTTATCCAACCTTCCTTTTGCTATATGGCCT
TGGTCACCAAGGGTGCGGTGCGAAAAGAGAGATGATCTGGCTGTGGTGGCTGTAGTTTTC
TGGGTGATGAAAACATGTTGCCTTGAACGTTTCCCTGGCACCCTATTGATCAGGACCTGT
AATTTCATTTCTCTTTAAATCCTCTGGACGTTGAGGCCTGGAGCTTGATGCATTGATCAC
GGAAAAAGCACAAGCGGATCAAAAGTTTCATACCAGTAGGGTGTCATTGTAGTTCTTTTC
CCAGTGTGATTTAGATTGTTACTCAGCGGGTATTTTCATATTCTTTTCCTCATATATGCT
GGACATGGATGGAGGAAAATCTTACTGATTTTCGTTATGTTGAAAAGGTTATGTTCCCCT
GAACACAAGC

CDS

987 bp

>Os03t0214600-02 Similar to 26S proteasome non-ATPase regulatory subunit 13.
TACAACAATTTCATCACTGATTTCGAGACGAAGATCAATCTTCTCAAACTTGCGCATTTC
GCGGTCATCGCTTCGCGCCAGTACCCCGACAAGGATGCTGCTATAAGTTTCCTCGAGGGG
GTAATCACAAAATTGCGCGAGACAAAGGACCTGCGCATCAATGAACCCATTCTCTACGTC
AAGATGCAAATCGCTGCGATTAACCTGGAGAAGGGAAATCAGAAGGAGTGCAAGAAACTT
TTGGACGAAGGAAAATCTACTCTAGATAGCATGACTGATGTTGATCCCACAGTTCATGCT
AGCCTCTACTGGATATCATCTCAGTACCATAAGGCTCGCCAAGAATTTGCTGAGTTCTAC
AAGAATGCCCTTCTGTATCTGGCTTACACTACTGTAGAGTCACTCTCTGAGTCTTTCAAA
CTGGATTTGGCATTTGATCTCTCCCTTGCAGCCTTGCTTGGTGATAACATCTACAACTTT
GGGGAATTGTTAGCTCACCCGATTATCAACAGTCTTATTGGAACCAAGGTGGAGTGGGTC
TATCATATGTTACAAGCATTCAACACCGGCAACCTAGCTCTCTACCAAGAACTATGTAGG
GTCCACAATGCTGCTCTCAGTGCTCAGCCAGCTTTGGTGCAGAATGAACGGAAACTGCTA
GAGAAGATCAACATTCTATGTCTGATGGAGATAATCTTTAGCCGGGCGTCAGAAGACAGA
ACTATCCCATTAAGTGTTATAGCCGAGCGCACTAAGCTTTCTATCAGTGATGTGGAATAT
CTTCTTATGAAGAGCCTCTCGGTTCATCTTATAGAGGGGATAATTGATGAGGTGGACAGC
ACAGTTCACGTGTCATGGGTCCAGCCTAGAGTACTTGGAATTCCACAGGTGAAGGCGTTG
CGCGAGCGGTTGGACGCCTGGGTTGGAAAAGTGCATACCACCCTGTTGTCCGTTGAGGCA
GAGACGCCTGATCTTGTAGCTGCATAA

Protein

329 aa

>Os03t0214600-02 Similar to 26S proteasome non-ATPase regulatory subunit 13.
YNNFITDFETKINLLKLAHFAVIASRQYPDKDAAISFLEGVITKLRETKDLRINEPILYV
KMQIAAINLEKGNQKECKKLLDEGKSTLDSMTDVDPTVHASLYWISSQYHKARQEFAEFY
KNALLYLAYTTVESLSESFKLDLAFDLSLAALLGDNIYNFGELLAHPIINSLIGTKVEWV
YHMLQAFNTGNLALYQELCRVHNAALSAQPALVQNERKLLEKINILCLMEIIFSRASEDR
TIPLSVIAERTKLSISDVEYLLMKSLSVHLIEGIIDEVDSTVHVSWVQPRVLGIPQVKAL
RERLDAWVGKVHTTLLSVEAETPDLVAA*

5'UTR

chr03:6000734..6000735 (+ strand) : 2 bp

CDS

chr03:6000736..6001158 (+ strand) : 423 bp

chr03:6001272..6001352 (+ strand) : 81 bp

chr03:6002058..6002254 (+ strand) : 197 bp

chr03:6002350..6002449 (+ strand) : 100 bp

chr03:6003182..6003367 (+ strand) : 186 bp

3'UTR

chr03:6003368..6003768 (+ strand) : 401 bp

FASTA

>Os03t0214600-02 class=Sequence position=chr03:6000734..6003768 (+ strand)
TCTACAACAA TTTCATCACT GATTTCGAGA CGAAGATCAA TCTTCTCAAA CTTGCGCATT TCGCGGTCAT CGCTTCGCGC
CAGTACCCCG ACAAGGATGC TGCTATAAGT TTCCTCGAGG GGGTAATCAC AAAATTGCGC GAGACAAAGG ACCTGCGCAT
CAATGAACCC ATTCTCTACG TCAAGATGCA AATCGCTGCG ATTAACCTGG AGAAGGGAAA TCAGAAGGAG TGCAAGAAAC
TTTTGGACGA AGGAAAATCT ACTCTAGATA GCATGACTGA TGTTGATCCC ACAGTTCATG CTAGCCTCTA CTGGATATCA
TCTCAGTACC ATAAGGCTCG CCAAGAATTT GCTGAGTTCT ACAAGAATGC CCTTCTGTAT CTGGCTTACA CTACTGTAGA
GTCACTCTCT GAGTCTTTCA AACTGGTATG TTCTATTGTT AACAATGCAA TTACATGACA AAAAATCATT TCCTCCTCGC
ATTATTTTAA TAATGTATCT TGCATCTATG TTTACCCTTT GATGCTGTCT TGTGTCAGGA TTTGGCATTT GATCTCTCCC
TTGCAGCCTT GCTTGGTGAT AACATCTACA ACTTTGGGGA ATTGTTAGCT CACCCGATTG TAAGTTGGAC TTTGCTTACG
CATGATTTCT TTTGTTGCCA CTAGTTAGTA GTACCACCTT TGTTTTATCC ATACTTTTTT GTGTTTCTTG ATTGCTTGAT
TAAAATTAAC TCTGCTTGCC TATATAAACA TTACATGTGG CTTTTCTTGG TACTCACAAC TGCCAGTTCT GATAATTATT
TATTAGTTGT TTTTATCTGA TGCTTGCTAG AACTGCAAGG CGTCCAAGGT ACCTGTGTAT GTTATGGTAG TTAAGTTTCG
GAGTTTTGTA CACAGTAACT TACATCTATT GCCAAATCGG TAGCAGAAAT TTCATGAGTT GAATGTATGC AGTTAACATT
GACACAATAA AATGCTACCG ATTGTGTAAA GCATATCAAA ATGATGAAAT ATCCTATGCC TGATCCTTTT TTGCTGAATG
TTGAATGATG TAATTGTGAA CCACTATATT ATAATTATGT AAACTTCGTA TTTTCTTGAA TTGAAATAGC ATAAACTTAA
GTTTGCATGA ATTAATGGCA AACCATCTTT TTTGTGCATG GAAAAATCAA TATTGACTTG TGGATACCAA ACAAAAAAAT
TCCAGACACA AGGTAGCCTT TATGGGATTG AAATATTGAA TGGCCCCTAA ATCTATATAT CGGCATATAT GGTTGTCATT
TGGTACATCT CTGTCTGAAG TTGTTTATAT TTTTATATCC TTAGATCAAC AGTCTTATTG GAACCAAGGT GGAGTGGGTC
TATCATATGT TACAAGCATT CAACACCGGC AACCTAGCTC TCTACCAAGA ACTATGTAGG GTCCACAATG CTGCTCTCAG
TGCTCAGCCA GCTTTGGTGC AGAATGAACG GAAACTGCTA GAGAAGATCA ACATTCTATG TCTGATGGAG ATAATCTTTA
GGTACAACTT TGCTACTTGC TTTTCTATGC CACCACAAAT GTCTTGCCCC TTTTCCTTTA TTCCTTCTAA GCCCTGTGTT
CTTTTTCATG TTGTAGCCGG GCGTCAGAAG ACAGAACTAT CCCATTAAGT GTTATAGCCG AGCGCACTAA GCTTTCTATC
AGTGATGTGG AATATCTTCT TATGAAGAGC CTCTCGGTAA TTGCATTTCT TACATTCGAT CTTTCATAAG ATATTATTTG
CAATATGCCA ATATCATGTT AATTCATTGT TGGGATAGAC AATGCATGAA TGCCATTCAT AAACATCTAG TTTTGTTGTG
CATAAATTGT TTTTTAAGAT TAGACATTAG AATGCTTCTA ATGCTTCTGT CATTTTAATG TGGCAGCTGT ATATGGATAG
TGATTATTTG ATAATTACTG CCTTCAATTC CTCCCCTTTG TGAACTTGTC TTTTTTTTTA ATTGCTGATG GTTTGTTTTG
TGAATCTTTA GTTGTGAGTT ATGGGTGTGC GTTGTCAGTT AAACTAGACA TGTGATTCAT ATATTTGTGT TTGTTGATCA
CAGCAAACCT GTGTCTCTCC TTGTTACATG CTACTATTGC TTTTACCTTA TACGGCTTCA GTGTTTGCAC AATGTATCAA
CTAGTATTCC TAGTTGATGT TCTCATCTTT TTCTTCCATT ACAGTTCTTT TCTACATCAG TTAGTACATT ATAGTATATA
ATAATGCTGC CCCTGAAAGG CAGAATATAT AGGTAGCCAA GATAGAATGC CACTGCTATC AGCTTCTTAC AAAAGCTCCA
TGCTGATGTT TTCTATTTAG TTGCTAATGG AGCCTGGGTG CTGTATTTCC ATGAGGCCAT CAATTGCCAT ACAATTTAAA
AGTAAATTGG AATATGAGAG AATTATTAAT GATTCCCCCA TTTTGCAGGT TCATCTTATA GAGGGGATAA TTGATGAGGT
GGACAGCACA GTTCACGTGT CATGGGTCCA GCCTAGAGTA CTTGGAATTC CACAGGTGAA GGCGTTGCGC GAGCGGTTGG
ACGCCTGGGT TGGAAAAGTG CATACCACCC TGTTGTCCGT TGAGGCAGAG ACGCCTGATC TTGTAGCTGC ATAACTTATC
CAACCTTCCT TTTGCTATAT GGCCTTGGTC ACCAAGGGTG CGGTGCGAAA AGAGAGATGA TCTGGCTGTG GTGGCTGTAG
TTTTCTGGGT GATGAAAACA TGTTGCCTTG AACGTTTCCC TGGCACCCTA TTGATCAGGA CCTGTAATTT CATTTCTCTT
TAAATCCTCT GGACGTTGAG GCCTGGAGCT TGATGCATTG ATCACGGAAA AAGCACAAGC GGATCAAAAG TTTCATACCA
GTAGGGTGTC ATTGTAGTTC TTTTCCCAGT GTGATTTAGA TTGTTACTCA GCGGGTATTT TCATATTCTT TTCCTCATAT
ATGCTGGACA TGGATGGAGG AAAATCTTAC TGATTTTCGT TATGTTGAAA AGGTTATGTT CCCCTGAACA CAAGC

Locus: Os03g0214600

Loading...

Locus: Os03g0214600

Loading...