Os03t0223200-00

Locus

Os03g0223200

Description

Similar to Cinnamyl alcohol dehydrogenase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CAD9

CGSNL Gene Name

CINNAMYL ALCOHOL DEHYDROGENASE 9

Oryzabase Gene Symbol Synonym(s)

OsCAD9

Oryzabase Gene Name Synonym(s)

Cinnamyl alcohol dehydrogenase 9

Transcript Evidence

AJ231135 (DDBJ)

Protein Evidence

C1M2W0 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

Functional domain (InterPro)

Alcohol dehydrogenase superfamily, zinc-type (IPR002085)

Alcohol dehydrogenase, zinc-type, conserved site (IPR002328)

GroES-like (IPR011032)

Alcohol dehydrogenase, C-terminal (IPR013149)

Alcohol dehydrogenase GroES-like (IPR013154)

NAD(P)-binding domain (IPR016040)

Polyketide synthase, enoylreductase (IPR020843)

Expression Databases

TENOR (Os03t0223200-00)

Others

Oryzabase (10440)

Transcript

1149 bp

>Os03t0223200-00 Similar to Cinnamyl alcohol dehydrogenase.
ACTATATATTGGGGAAAAGAACCTCATCCCTCTTCAGCCAACATAATCAAGAAGACAGGG
ATGGAGCAGCAACCTAAGATGGTGACCGGATGGGCGGCAAGAGACGCCAACGGGCTGCTC
TCTCCTTTCTCTTACCCCCTCAGAGCTAAGGGAGACGAAGACGTCGTTGTCAAGATACTG
TTCTGTGGCATTTGCCACTCTGATCTTTCTACTATCAAGAACGAGTGGGGCAACGCCAAG
TATCCCGTAGTACCAGGTCATGAAATCGTTGGGGTCGTCGCCGAGGTCGGGAGCAGCGTG
GCGAGGTTCGCCGCCGGCGACACTGTCGGCGTCGGGTACATCGCCAGCACATGCCGCGCC
TGCGCCAACTGCCGCGACGGCTTCGAGAACTACTGCGCGGGCCTCGTGCCGTCCTTCAAC
GCCGCGCTCCCCGACGGCGCTACGGTGCACGGCGGCTTCTCGGAGCTGGCCGTCGTCAAC
CAGCGGTACGTCGTCCGGATCCCCGGCGGCGGCGGCGGCGCGTCGCCGGCGCCGCTCGAC
CGCTTGGCGCCGCTGCTGTGCGCCGGCGTCACGGTGTACTGCCCCATGAGGCGGCTCGGG
CTGGACAGGCCAGGGGTGCACCTCGGCGTGGCCGGGCTCGGCGGCCTCGGCCATCTCGCT
GTCAAGTTCGGCAAGGCGTTCGGCGTGAAGGTGACCGTGATCAGCACCAGCCCGTGGAAG
GAAGCGGAGGCCGTGGAGAGGCTTGGCGCCGACGCGTTCTTGCTCAGCACCAACGCCGAA
CAGATGAAGGCAGCTGCGGGCACCATGGATGGCATCATCGACACGGTCTCGGCGGTGCAC
GACCTGACGCCACTCATCACGCTGCTGCGGACTCACGGCCAGCTCGTCCCGGTCGGATCG
CCGGGAAAGCCGGTGCAACTAGCCCTGTACCCTCTGCAATCAGATGGGAAGAGCGTGGCC
GGGAGCATGATCGGCGGGATGAGGGATACGCAGGAGATGGTCGACTTCGCCGTCGAGCAC
GGCGTCGCCGCCGAGGTGGAGGTCATCGGCATGGAGGACGTCAACGGCGCGATGGAGAGG
CTGCAGAAGGGAGACGTGAGGTACAGGTTTGTGATCGACGTAGCCAACACAATGGCCCGT
GCTCGTTAG

CDS

1149 bp

>Os03t0223200-00 Similar to Cinnamyl alcohol dehydrogenase.
ACTATATATTGGGGAAAAGAACCTCATCCCTCTTCAGCCAACATAATCAAGAAGACAGGG
ATGGAGCAGCAACCTAAGATGGTGACCGGATGGGCGGCAAGAGACGCCAACGGGCTGCTC
TCTCCTTTCTCTTACCCCCTCAGAGCTAAGGGAGACGAAGACGTCGTTGTCAAGATACTG
TTCTGTGGCATTTGCCACTCTGATCTTTCTACTATCAAGAACGAGTGGGGCAACGCCAAG
TATCCCGTAGTACCAGGTCATGAAATCGTTGGGGTCGTCGCCGAGGTCGGGAGCAGCGTG
GCGAGGTTCGCCGCCGGCGACACTGTCGGCGTCGGGTACATCGCCAGCACATGCCGCGCC
TGCGCCAACTGCCGCGACGGCTTCGAGAACTACTGCGCGGGCCTCGTGCCGTCCTTCAAC
GCCGCGCTCCCCGACGGCGCTACGGTGCACGGCGGCTTCTCGGAGCTGGCCGTCGTCAAC
CAGCGGTACGTCGTCCGGATCCCCGGCGGCGGCGGCGGCGCGTCGCCGGCGCCGCTCGAC
CGCTTGGCGCCGCTGCTGTGCGCCGGCGTCACGGTGTACTGCCCCATGAGGCGGCTCGGG
CTGGACAGGCCAGGGGTGCACCTCGGCGTGGCCGGGCTCGGCGGCCTCGGCCATCTCGCT
GTCAAGTTCGGCAAGGCGTTCGGCGTGAAGGTGACCGTGATCAGCACCAGCCCGTGGAAG
GAAGCGGAGGCCGTGGAGAGGCTTGGCGCCGACGCGTTCTTGCTCAGCACCAACGCCGAA
CAGATGAAGGCAGCTGCGGGCACCATGGATGGCATCATCGACACGGTCTCGGCGGTGCAC
GACCTGACGCCACTCATCACGCTGCTGCGGACTCACGGCCAGCTCGTCCCGGTCGGATCG
CCGGGAAAGCCGGTGCAACTAGCCCTGTACCCTCTGCAATCAGATGGGAAGAGCGTGGCC
GGGAGCATGATCGGCGGGATGAGGGATACGCAGGAGATGGTCGACTTCGCCGTCGAGCAC
GGCGTCGCCGCCGAGGTGGAGGTCATCGGCATGGAGGACGTCAACGGCGCGATGGAGAGG
CTGCAGAAGGGAGACGTGAGGTACAGGTTTGTGATCGACGTAGCCAACACAATGGCCCGT
GCTCGTTAG

Protein

383 aa

>Os03t0223200-00 Similar to Cinnamyl alcohol dehydrogenase.
TIYWGKEPHPSSANIIKKTGMEQQPKMVTGWAARDANGLLSPFSYPLRAKGDEDVVVKIL
FCGICHSDLSTIKNEWGNAKYPVVPGHEIVGVVAEVGSSVARFAAGDTVGVGYIASTCRA
CANCRDGFENYCAGLVPSFNAALPDGATVHGGFSELAVVNQRYVVRIPGGGGGASPAPLD
RLAPLLCAGVTVYCPMRRLGLDRPGVHLGVAGLGGLGHLAVKFGKAFGVKVTVISTSPWK
EAEAVERLGADAFLLSTNAEQMKAAAGTMDGIIDTVSAVHDLTPLITLLRTHGQLVPVGS
PGKPVQLALYPLQSDGKSVAGSMIGGMRDTQEMVDFAVEHGVAAEVEVIGMEDVNGAMER
LQKGDVRYRFVIDVANTMARAR*

CDS

chr03:6453022..6453164 (+ strand) : 143 bp

chr03:6454146..6454259 (+ strand) : 114 bp

chr03:6454354..6454885 (+ strand) : 532 bp

chr03:6454958..6455111 (+ strand) : 154 bp

chr03:6455248..6455453 (+ strand) : 206 bp

FASTA

>Os03t0223200-00 class=Sequence position=chr03:6453022..6455453 (+ strand)
ACTATATATT GGGGAAAAGA ACCTCATCCC TCTTCAGCCA ACATAATCAA GAAGACAGGG ATGGAGCAGC AACCTAAGAT
GGTGACCGGA TGGGCGGCAA GAGACGCCAA CGGGCTGCTC TCTCCTTTCT CTTACCCCCT CAGGTGATCT CTAGCTCTCT
TGCTCTATCT TTTTCCTGTG TGTTCAGATG TTCCTGGGTC TTGAAATATT CAAAGAGAAG TTCACACAAA ATTCTTGAGT
TATACCGTTT TCTTTTTATG AAAGCAAAGT TACTGATAAA TAGTCAATAG TCATCTCCAT TACTTCGTTA ATTAATTGTA
GTCAGGAATT CTAGTTTTGA ACGGGTACCA TCAAACTGTA TCGATCGAGA TTTATGAGGA ATATGGAATT GCCTTTGACA
ATTGACGCAC CAAGCACATA AACGCTGCCG TCTACGTTTT CTACCGGTCT CCGGTGATAT TTTCTTTGTG TAATGACCGA
TGAGAAGTAC TGCATGGCTC ATTGGTTCTG TAACTCTGTT AATTATTGAA AAATAACTAA ATTGCTTCAG TCAGTCAGTA
GTAACCAATC GTTGGGTTGC CACTCTAACG AAAACATCAC TGGTGTACTG CTATATAGAA ATTAGAACAC TGAGAACTAA
AGAGGTAGTA TTGTCTGTTG AGTTTTGAGC ATTTTTCAAG AAATTTGCAG CTACACAATG CGTTCTGAAT TACATTTTTT
GATTAAAAAG AAACTTATGC TTGGATTGCA AAGATATATC ATTTACTGCA GGAAAGTAAA GGCTACACGG GTGATGACCA
ATTATGCACT ATACATTCAT CATGAAGCCT CGATTGCCAT CTTTTAGAAA GAATGAATGA TAGCCATTCA GTAGGTAGTA
GTGGCGACGC ACTCATACCC AACTTCCACG GCTGAAAGGA ATCAAACCAT TTTGGCACCG ATGGCTTGTT TGCACGCCAT
TGGGCGAGTT CGAGTCGTTG CAACAGCATT TCTTCCATTA TTCACCTGCT GATTTATGTT TATGCATTGT CAAACTATAT
GCATTCTCCC CAATTGTTTT CTTTTTCGTG AGTACAGAAA AGGGTTAATT AATCGTCATT TCCACCGTGC ATTTCATATT
TCAGAGCTAA GGGAGACGAA GACGTCGTTG TCAAGATACT GTTCTGTGGC ATTTGCCACT CTGATCTTTC TACTATCAAG
AACGAGTGGG GCAACGCCAA GTATCCCGTA GTACCAGGGT CAGTACGTAC ACATGCAATG CAAATCGGCT AATGCGCAAC
AGAATTATCC AGAGATATAT TATTGATCGA TCGTTTTGCG TGCTTAATCC AGTCATGAAA TCGTTGGGGT CGTCGCCGAG
GTCGGGAGCA GCGTGGCGAG GTTCGCCGCC GGCGACACTG TCGGCGTCGG GTACATCGCC AGCACATGCC GCGCCTGCGC
CAACTGCCGC GACGGCTTCG AGAACTACTG CGCGGGCCTC GTGCCGTCCT TCAACGCCGC GCTCCCCGAC GGCGCTACGG
TGCACGGCGG CTTCTCGGAG CTGGCCGTCG TCAACCAGCG GTACGTCGTC CGGATCCCCG GCGGCGGCGG CGGCGCGTCG
CCGGCGCCGC TCGACCGCTT GGCGCCGCTG CTGTGCGCCG GCGTCACGGT GTACTGCCCC ATGAGGCGGC TCGGGCTGGA
CAGGCCAGGG GTGCACCTCG GCGTGGCCGG GCTCGGCGGC CTCGGCCATC TCGCTGTCAA GTTCGGCAAG GCGTTCGGCG
TGAAGGTGAC CGTGATCAGC ACCAGCCCGT GGAAGGAAGC GGAGGCCGTG GAGAGGCTTG GCGCCGACGC GTTCTTGCTC
AGCACCAACG CCGAACAGAT GAAGGTGACC AAAAAACACC GATCTGTGCG CCATTTTGCA TCCGAATTCT GAAGCTAAGA
ACCACCATAT GTGCAGGCAG CTGCGGGCAC CATGGATGGC ATCATCGACA CGGTCTCGGC GGTGCACGAC CTGACGCCAC
TCATCACGCT GCTGCGGACT CACGGCCAGC TCGTCCCGGT CGGATCGCCG GGAAAGCCGG TGCAACTAGC CCTGTACCCT
CTGCAATCAG GTGCGTGTGG TTCATCATTA CTGGGCCTTA CAGCCTCACA CCAAACCAGG CCCATCACCA GTTGGCCCGC
GAATAGATTG GGCTGGAGGC CCAATCAGAG CTAGATGGGC CGTGCTCATG GTGTGCGATG TGGCAGATGG GAAGAGCGTG
GCCGGGAGCA TGATCGGCGG GATGAGGGAT ACGCAGGAGA TGGTCGACTT CGCCGTCGAG CACGGCGTCG CCGCCGAGGT
GGAGGTCATC GGCATGGAGG ACGTCAACGG CGCGATGGAG AGGCTGCAGA AGGGAGACGT GAGGTACAGG TTTGTGATCG
ACGTAGCCAA CACAATGGCC CGTGCTCGTT AG

Locus: Os03g0223200

Loading...

Locus: Os03g0223200

Loading...