Os03t0224200-01

Locus

Os03g0224200

Description

B-type response regulator, Cytokinin signaling

RAP-DB Gene Symbol Synonym(s)

RR21, OsRR21, Rrb1, Orr1, OsRR19, OsRRB1, ORR1

RAP-DB Gene Name Synonym(s)

B-TYPE RESPONSE REGULATOR 1, B-type response regulator 1, B-type RR 1, ORYZA SATIVA RESPONSE REGULATOR 1

CGSNL Gene Symbol

RR21

CGSNL Gene Name

B-TYPE RESPONSE REGULATOR 1

Oryzabase Gene Symbol Synonym(s)

OsRR21, Rrb1, Orr1, OsRR19, OsRRB1, ORR1

Oryzabase Gene Name Synonym(s)

B-type response regulator 1, B-type RR 1, ORYZA SATIVA RESPONSE REGULATOR 1

Transcript Evidence

BR000250 (DDBJ)

AK111864 (DDBJ)

AK111899 (DDBJ)

Protein Evidence

Q8H7S7 (UniProt)

Literature

PMID: 16919402

PMID: 17293362

Note

Manual Curation

May 20, 2010

Gene Ontology (GO)

Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: two-component response regulator activity (GO:0000156)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Signal transduction response regulator, receiver domain (IPR001789)

Myb-like DNA-binding domain, SHAQKYF class (IPR006447)

Homeodomain-like (IPR009057)

CheY-like superfamily (IPR011006)

Homeodomain-related (IPR012287)

Myb, DNA-binding (IPR014778)

Response regulator, plant B-type (IPR017053)

Transcription regulator HTH, Myb-type, DNA-binding (IPR017930)

Full-length cDNA

J033025G23 (Online Clone Ordering)

J023034P21 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0224200-01)

Others

Oryzabase (8148)

Transcript

2607 bp

>Os03t0224200-01 B-type response regulator, Cytokinin signaling
AGTCTTCTCTCTTCTCTCTCTCTCGTCTCTCTCTCCCCCACCTCTTCTTCCCTTTCCCCC
GCCTCCCTCTCCTCTTCGTCGTCACCCGCCGCCTCCCGCTGAATCCGCGGCTTGGGAGGA
GACGCCGGAGTCGGGGGCGTGGACGGGGGTTGGATCTGCTTGCCTTGATGGTGGCGATTG
GAGCGTGAATTCGTGAGGGGGGCGTGGTGGTGGTGGTGGTGGTTATACGGTTTTCGGTTT
CGTGGGCGGGGGAGAGATGGCGCCGGTGGAGGATGGCGGCGGGGTGGAGTTCCCCGTGGG
GATGAAGGTGCTGGTGGTGGACGACGACCCTACATGCCTCGCCGTGCTCAAGAGGATGCT
CCTCGAGTGCCGCTACGACGCGACAACTTGTTCTCAGGCTACAAGAGCATTAACTATGCT
GCGAGAGAACAGGCGTGGTTTTGATGTTATAATTAGCGATGTTCATATGCCTGATATGGA
CGGATTCAGGTTACTTGAACTTGTTGGCCTTGAGATGGATCTCCCAGTTATTATGATGTC
TGCTGATTCAAGGACAGATATCGTTATGAAAGGAATAAAACATGGAGCATGTGACTACTT
AATTAAACCCGTCAGAATGGAGGAGTTGAAGAACATCTGGCAACATGTTATAAGGAAAAA
GTTTAATGAAAACAAGGAGCATGAGCATTCAGGTAGCCTAGATGATACAGATCGTACCAG
ACCAACCAATAACGATAATGAGTATGCTTCATCTGCAAATGATGGAGCTGAAGGTAGCTG
GAAGTCTCAGAAAAAGAAACGGGATAAAGATGATGACGATGGTGAATTGGAAAGTGGTGA
CCCTTCTTCTACATCAAAGAAACCAAGAGTTGTTTGGTCAGTTGAACTCCACCAACAATT
TGTAAACGCAGTTAATCATCTGGGGATAGACAAAGCTGTTCCCAAGAAAATTTTGGAGTT
GATGAATGTTCCTGGTTTAACTAGGGAAAATGTCGCCAGCCATTTGCAGAAGTTCAGATT
GTATCTGAAGAGGATTGCTCAGCATCATGCCGGAATAGCTAATCCATTCTGCCCGCCTGC
TTCTAGTGGTAAAGTAGGCTCACTGGGAGGACTTGATTTCCAAGCTTTGGCTGCCTCAGG
TCAGATCCCTCCTCAAGCCCTGGCCGCCTTGCAGGATGAGCTCCTAGGGCGACCTACAAA
TAGTTTGGTATTGCCTGGAAGGGACCAGTCATCTTTACGGCTTGCTGCAGTCAAAGGAAA
CAAGCCCCATGGGGAGAGAGAAATAGCATTTGGTCAACCTATATACAAGTGCCAGAATAA
TGCATATGGGGCATTCCCTCAAAGCAGTCCAGCTGTTGGAGGAATGCCTTCATTTTCAGC
TTGGCCCAATAACAAACTTGGTATGGCAGACTCAACCGGCACATTGGGAGGCATGAGTAA
TTCTCAGAATAGCAATATAGTCTTGCATGAATTGCAACAGCAGCCAGATGCCATGCTGTC
AGGAACCCTTCACTCTCTAGATGTCAAACCTTCTGGGATAGTTATGCCTTCTCAGTCATT
AAATACTTTCTCAGCCAGTGAGGGTCTCTCCCCTAATCAAAATACCTTGATGATACCTGC
TCAGTCATCTGGTTTTCTAGCGGCCATGCCTCCATCCATGAAGCATGAACCTGTTCTTGC
AACTTCTCAACCATCGAGTAGTCTGTTAGGTGGTATTGATTTGGTTAATCAAGCTTCAAC
AAGTCAGCCCTTAATAAGTGCCCATGGAGGGGGGAATCTTTCTGGCCTTGTAAATCGTAA
TCCAAATGTAGTACCTTCTCAAGGGATCAGTACTTTTCATACTCCAAATAATCCATATTT
GGTTAGTCCAAATTCTATGGGAATGGGCTCCAAACAACCACCTGGTGTTCTTAAGACAGA
AAACTCTGACGCTCTGAACCATAGCTATGGTTATCTTGGTGGTAGCAACCCCCCTATGGA
CTCTGGCTTACTCTCTTCACAATCAAAAAATACACAGTTTGGTTTACTGGGTCAGGATGA
CATCACTGGTAGCTGGTCGCCTCTGCCGAATGTTGACAGTTATGGTAATACTGTTGGGCT
AAGCCACCCTGGGTCCAGTTCATCTAGTTTTCAAAGTTCTAATGTGGCTCTTGGGAAATT
GCCTGATCAAGGGCGAGGAAAGAATCATGGATTTGTTGGTAAAGGTACTTGCATTCCAAG
CCGCTTTGCAGTGGATGAGATTGAATCTCCAACTAACAACTTGAGTCACAGCATTGGAAG
CAGTGGAGATATTATGAGCCCTGATATTTTCGGATTTAGTGGACAGATGTGAAGGCTTCT
TGAATTTGTAAGTAGGGTAATCACTGGAAACAATTTTTAGTGGGTTGATGAACGGTTGCC
GTGTTTTTCATTTCATCCTTTTTTTTTTCCTTCTGTAATTGGTTTATAAAGGGAATAATT
TATGTGACAGCATGTCGAATCTTGGTTTATAGAAGGTTGTTCGGTTTAAACAACTTTGGA
TTATTTAGCCTCATGTGACATAGCTCATTTTCCTTTGTTCATTTTTTGTGTACAGTTTTC
TGATTTTGTTGCAAATCTTCTTCTCTC

CDS

2076 bp

>Os03t0224200-01 B-type response regulator, Cytokinin signaling
ATGGCGCCGGTGGAGGATGGCGGCGGGGTGGAGTTCCCCGTGGGGATGAAGGTGCTGGTG
GTGGACGACGACCCTACATGCCTCGCCGTGCTCAAGAGGATGCTCCTCGAGTGCCGCTAC
GACGCGACAACTTGTTCTCAGGCTACAAGAGCATTAACTATGCTGCGAGAGAACAGGCGT
GGTTTTGATGTTATAATTAGCGATGTTCATATGCCTGATATGGACGGATTCAGGTTACTT
GAACTTGTTGGCCTTGAGATGGATCTCCCAGTTATTATGATGTCTGCTGATTCAAGGACA
GATATCGTTATGAAAGGAATAAAACATGGAGCATGTGACTACTTAATTAAACCCGTCAGA
ATGGAGGAGTTGAAGAACATCTGGCAACATGTTATAAGGAAAAAGTTTAATGAAAACAAG
GAGCATGAGCATTCAGGTAGCCTAGATGATACAGATCGTACCAGACCAACCAATAACGAT
AATGAGTATGCTTCATCTGCAAATGATGGAGCTGAAGGTAGCTGGAAGTCTCAGAAAAAG
AAACGGGATAAAGATGATGACGATGGTGAATTGGAAAGTGGTGACCCTTCTTCTACATCA
AAGAAACCAAGAGTTGTTTGGTCAGTTGAACTCCACCAACAATTTGTAAACGCAGTTAAT
CATCTGGGGATAGACAAAGCTGTTCCCAAGAAAATTTTGGAGTTGATGAATGTTCCTGGT
TTAACTAGGGAAAATGTCGCCAGCCATTTGCAGAAGTTCAGATTGTATCTGAAGAGGATT
GCTCAGCATCATGCCGGAATAGCTAATCCATTCTGCCCGCCTGCTTCTAGTGGTAAAGTA
GGCTCACTGGGAGGACTTGATTTCCAAGCTTTGGCTGCCTCAGGTCAGATCCCTCCTCAA
GCCCTGGCCGCCTTGCAGGATGAGCTCCTAGGGCGACCTACAAATAGTTTGGTATTGCCT
GGAAGGGACCAGTCATCTTTACGGCTTGCTGCAGTCAAAGGAAACAAGCCCCATGGGGAG
AGAGAAATAGCATTTGGTCAACCTATATACAAGTGCCAGAATAATGCATATGGGGCATTC
CCTCAAAGCAGTCCAGCTGTTGGAGGAATGCCTTCATTTTCAGCTTGGCCCAATAACAAA
CTTGGTATGGCAGACTCAACCGGCACATTGGGAGGCATGAGTAATTCTCAGAATAGCAAT
ATAGTCTTGCATGAATTGCAACAGCAGCCAGATGCCATGCTGTCAGGAACCCTTCACTCT
CTAGATGTCAAACCTTCTGGGATAGTTATGCCTTCTCAGTCATTAAATACTTTCTCAGCC
AGTGAGGGTCTCTCCCCTAATCAAAATACCTTGATGATACCTGCTCAGTCATCTGGTTTT
CTAGCGGCCATGCCTCCATCCATGAAGCATGAACCTGTTCTTGCAACTTCTCAACCATCG
AGTAGTCTGTTAGGTGGTATTGATTTGGTTAATCAAGCTTCAACAAGTCAGCCCTTAATA
AGTGCCCATGGAGGGGGGAATCTTTCTGGCCTTGTAAATCGTAATCCAAATGTAGTACCT
TCTCAAGGGATCAGTACTTTTCATACTCCAAATAATCCATATTTGGTTAGTCCAAATTCT
ATGGGAATGGGCTCCAAACAACCACCTGGTGTTCTTAAGACAGAAAACTCTGACGCTCTG
AACCATAGCTATGGTTATCTTGGTGGTAGCAACCCCCCTATGGACTCTGGCTTACTCTCT
TCACAATCAAAAAATACACAGTTTGGTTTACTGGGTCAGGATGACATCACTGGTAGCTGG
TCGCCTCTGCCGAATGTTGACAGTTATGGTAATACTGTTGGGCTAAGCCACCCTGGGTCC
AGTTCATCTAGTTTTCAAAGTTCTAATGTGGCTCTTGGGAAATTGCCTGATCAAGGGCGA
GGAAAGAATCATGGATTTGTTGGTAAAGGTACTTGCATTCCAAGCCGCTTTGCAGTGGAT
GAGATTGAATCTCCAACTAACAACTTGAGTCACAGCATTGGAAGCAGTGGAGATATTATG
AGCCCTGATATTTTCGGATTTAGTGGACAGATGTGA

Protein

692 aa

>Os03t0224200-01 B-type response regulator, Cytokinin signaling
MAPVEDGGGVEFPVGMKVLVVDDDPTCLAVLKRMLLECRYDATTCSQATRALTMLRENRR
GFDVIISDVHMPDMDGFRLLELVGLEMDLPVIMMSADSRTDIVMKGIKHGACDYLIKPVR
MEELKNIWQHVIRKKFNENKEHEHSGSLDDTDRTRPTNNDNEYASSANDGAEGSWKSQKK
KRDKDDDDGELESGDPSSTSKKPRVVWSVELHQQFVNAVNHLGIDKAVPKKILELMNVPG
LTRENVASHLQKFRLYLKRIAQHHAGIANPFCPPASSGKVGSLGGLDFQALAASGQIPPQ
ALAALQDELLGRPTNSLVLPGRDQSSLRLAAVKGNKPHGEREIAFGQPIYKCQNNAYGAF
PQSSPAVGGMPSFSAWPNNKLGMADSTGTLGGMSNSQNSNIVLHELQQQPDAMLSGTLHS
LDVKPSGIVMPSQSLNTFSASEGLSPNQNTLMIPAQSSGFLAAMPPSMKHEPVLATSQPS
SSLLGGIDLVNQASTSQPLISAHGGGNLSGLVNRNPNVVPSQGISTFHTPNNPYLVSPNS
MGMGSKQPPGVLKTENSDALNHSYGYLGGSNPPMDSGLLSSQSKNTQFGLLGQDDITGSW
SPLPNVDSYGNTVGLSHPGSSSSSFQSSNVALGKLPDQGRGKNHGFVGKGTCIPSRFAVD
EIESPTNNLSHSIGSSGDIMSPDIFGFSGQM*

5'UTR

chr03:6512771..6513026 (+ strand) : 256 bp

CDS

chr03:6513027..6513150 (+ strand) : 124 bp

chr03:6514853..6515005 (+ strand) : 153 bp

chr03:6515088..6515486 (+ strand) : 399 bp

chr03:6515664..6515740 (+ strand) : 77 bp

chr03:6516496..6517818 (+ strand) : 1323 bp

3'UTR

chr03:6517819..6517841 (+ strand) : 23 bp

chr03:6518260..6518511 (+ strand) : 252 bp

FASTA

>Os03t0224200-01 class=Sequence position=chr03:6512771..6518511 (+ strand)
AGTCTTCTCT CTTCTCTCTC TCTCGTCTCT CTCTCCCCCA CCTCTTCTTC CCTTTCCCCC GCCTCCCTCT CCTCTTCGTC
GTCACCCGCC GCCTCCCGCT GAATCCGCGG CTTGGGAGGA GACGCCGGAG TCGGGGGCGT GGACGGGGGT TGGATCTGCT
TGCCTTGATG GTGGCGATTG GAGCGTGAAT TCGTGAGGGG GGCGTGGTGG TGGTGGTGGT GGTTATACGG TTTTCGGTTT
CGTGGGCGGG GGAGAGATGG CGCCGGTGGA GGATGGCGGC GGGGTGGAGT TCCCCGTGGG GATGAAGGTG CTGGTGGTGG
ACGACGACCC TACATGCCTC GCCGTGCTCA AGAGGATGCT CCTCGAGTGC CGCTACGACG GTGAGCAGCT CTGCCTTCGC
CTCTGCCTCT CCCGCGTTCT CTGTCCTTGT AGTCTATCGC TTGCTGTGCT GCGGTTGTGT GGGCGTGACA TGATTGGTTG
CGTGGAGGCG GTTGGTCGGA TAAGTTTCGT TGTTTCGGTT AGTGTTTCGT GTTCCGATTT GTCTGGGGTT GGGGAGGAGT
CGGCTGCTCC GTGGGTTGAT TTGCTTTTCC GTGAATTCTG GGGAGTTTTT ATTTTTTTTC TGCACATCTC CGTTATTGGG
AATTTTTGCC CTTATTGTCG GTTTTCTCAA TCTGGGAATA GATTGTTGAG TTTATATAGA TTAGTGATTG TATTGGAGAT
CTGAGCGAGT TTGCGGTGTG AAATCTGAAC CGTGTTGCTA ATATCTAATC CTGCCTTTTT GTTTGTGCTA ATATAAGCAG
TAGTTTTTAA GATTCTTAgg ccagtcacaa tgggggtttc actggtgtgt catgcacatt taataggggt aagactgaat
aaaaaatgat tatttgcatg aaatggggat gagagagaag gaaagagttt catcctggtg aaactcgtca gcgtcgtttc
caagtcctcg gtaacagagt gaaacccccg ttgaggccga ttcgtttcat tcaccggatc tcttgcgtcc gcctccgccg
tgcgacctcc gcattctccc gcgccgcgcc ggattttggg tacaaatgat cccagcaact tgtatcaatt aaatgctttg
cttagtcttg gaaacgtcaa agtgaaaccc ctccactgtg gggattgttt cataaaagat ttcatttgag agaagatggt
ataatatttt gggtagccgt gcaatgacac tagccattgt gactggccTT ATATTCTGTG GATTCATGCG GGCTTCGAAT
TACTATTATA TCATCCCAAC CTAAGACTTG CAATATATTG GGAATATATC GTCGATGCTC CTAGCTTTTG TTCCCTATCC
CGATAACATT TTGTTATGCC TAATGACTGT GAATTATCAC CCATAGTAAT GACTGCAAAT TATCACGGAA AGTTTAGCTT
AGGATCAGGA GTTTATTAGA GGCGCTATGC ATCACCCACC TACCCCACAG TTAAGTTTTG TTGCAACAGG AACGAATACT
CCAAGGATGC AATGCGGCAT ATCTAGGTTG CAGCCTATAT AGAATCTTTG TTCTGTAAAG TGTTGCTATT CCTTTCTAGT
TTCTGTTCTG GGCGCCAATA GTTCACATAT GCGCATCACA GCTTAGGGGA AATAACAAAT AATATAATGG GTTTATTACT
GATCTATTTT TTCTTATTAT ATTACAGTTG ATTTATTTCC TACTATAAGT TGAATGTGTG CAGCATGAGA AACTGTTGGA
TTTTATTCCT TATCCAGTCT TCTCTATTGA ATGATCTCTG CTTTAAAACG AACGTGAAAA GCATTAGGCA TACCCATGGA
GGTATTCAGT ATTCATAATG TAATGCAATT GTACATAAAT ATCATCTGCT GCTTTTATGC CTTCAAATAC ACTTTTAAGT
TTATATCATG TTGTGTGCAG TACTTTTTCG TTGCTTTGTT TTGTTTTCAC TCTGTTGTTT CCGAAAATTC CACTCGTTCG
TGGGAAGCTA ATATCGTAAT TTGCATCTGC TTCATTTGTA TGTCTGAATA GTTATTTTGT TTACTTTGTT TTTTTTGGGC
AGCGACAACT TGTTCTCAGG CTACAAGAGC ATTAACTATG CTGCGAGAGA ACAGGCGTGG TTTTGATGTT ATAATTAGCG
ATGTTCATAT GCCTGATATG GACGGATTCA GGTTACTTGA ACTTGTTGGC CTTGAGATGG ATCTCCCAGT TATTAGTAAG
TAGATTAATA TTCTCCACCC TGCTTGTTAA TTCTGGTTTG TCAAAGGCAT TACTGAAATC TGTTGATAAT ATTGCAGTGA
TGTCTGCTGA TTCAAGGACA GATATCGTTA TGAAAGGAAT AAAACATGGA GCATGTGACT ACTTAATTAA ACCCGTCAGA
ATGGAGGAGT TGAAGAACAT CTGGCAACAT GTTATAAGGA AAAAGTTTAA TGAAAACAAG GAGCATGAGC ATTCAGGTAG
CCTAGATGAT ACAGATCGTA CCAGACCAAC CAATAACGAT AATGAGTATG CTTCATCTGC AAATGATGGA GCTGAAGGTA
GCTGGAAGTC TCAGAAAAAG AAACGGGATA AAGATGATGA CGATGGTGAA TTGGAAAGTG GTGACCCTTC TTCTACATCA
AAGAAACCAA GAGTTGTTTG GTCAGTTGAA CTCCACCAAC AATTTGTAAA CGCAGTTAAT CATCTGGGGA TAGACAGTAA
GTTTTTCCTA CTTTTGGCAC TTATTTTCAT CAACAGCAAT GTTTGGTCGG CTGTACACTT GCTAATTTAT TTTTCTTTTG
GTGTTGTTTA CCACATTTGA ACACCTGAAC CTTGCAATTA CATCAAATCT TTCCGCTTTC AAGCTTACAC AAATTTTATA
ATTTTCTCTT CAGAAGCTGT TCCCAAGAAA ATTTTGGAGT TGATGAATGT TCCTGGTTTA ACTAGGGAAA ATGTCGCCAG
CCATTTGCAG GTTTGATTCT GGTTTTCATT TTTAATCACG GGTCCTTTTT CTTGTATCAT ATTTAGCATG GTGTGGTGGA
TGTTATGTTT ACTGGCACCA TGGAATATCT ACCCTTTTGT ATTATCCTAA TTGTTATTAT TCGTATTTAT TTTACACATC
CTTGCTCTAC CTGAATGTAT CTACTCTGAT TTAATTAGCA GTAGAAACCA ACTAACCAAA GGACTTGCTC CTGGAATGAT
CTTGTAATTC CAGGGACTTG TACATACACT ATTTTAGTGC TGTTACACTC TTTTATTGTA GAATGAAACC ATACCAAATT
ATAGATCATT CAACCAGTGC AGATGGCAAC GAATCGCTCT ATAATAGATG TTTGATAATA AACATTGTTT TTCTGTTGTT
CTTATTGTGT TGCCTGGGGA TCATCCATTT GAAGGTTTTG TCTACAGAGT AAAATTCCAT TGGTTACCTT GTGCATTTGT
GCTGCTTGTC TGTTGAGCTC CAATCTCCCT GTTACCTTCA TTTTTTTAAT ATATACCAGG ACCTGTTTAA GTGCTTAGTT
CAATAGTCAT GATATACAGT AGCTTAGACC CTGTTTGAAC TCAGGACGTC CCTAAGTTAT CTTGAAACAA TGTCGTTTTT
CTTGGGCATA TTGAAGTTGC TGAAACAGTA ATGAAGTATC TGTTTGCTCT TGCTGTAACT TCCAGTTTTT TAGTTATGTA
ATGATAATCA TGGTGATGCA ATGAGTTTTT TTTTTCTATT TTCAGAAGTT CAGATTGTAT CTGAAGAGGA TTGCTCAGCA
TCATGCCGGA ATAGCTAATC CATTCTGCCC GCCTGCTTCT AGTGGTAAAG TAGGCTCACT GGGAGGACTT GATTTCCAAG
CTTTGGCTGC CTCAGGTCAG ATCCCTCCTC AAGCCCTGGC CGCCTTGCAG GATGAGCTCC TAGGGCGACC TACAAATAGT
TTGGTATTGC CTGGAAGGGA CCAGTCATCT TTACGGCTTG CTGCAGTCAA AGGAAACAAG CCCCATGGGG AGAGAGAAAT
AGCATTTGGT CAACCTATAT ACAAGTGCCA GAATAATGCA TATGGGGCAT TCCCTCAAAG CAGTCCAGCT GTTGGAGGAA
TGCCTTCATT TTCAGCTTGG CCCAATAACA AACTTGGTAT GGCAGACTCA ACCGGCACAT TGGGAGGCAT GAGTAATTCT
CAGAATAGCA ATATAGTCTT GCATGAATTG CAACAGCAGC CAGATGCCAT GCTGTCAGGA ACCCTTCACT CTCTAGATGT
CAAACCTTCT GGGATAGTTA TGCCTTCTCA GTCATTAAAT ACTTTCTCAG CCAGTGAGGG TCTCTCCCCT AATCAAAATA
CCTTGATGAT ACCTGCTCAG TCATCTGGTT TTCTAGCGGC CATGCCTCCA TCCATGAAGC ATGAACCTGT TCTTGCAACT
TCTCAACCAT CGAGTAGTCT GTTAGGTGGT ATTGATTTGG TTAATCAAGC TTCAACAAGT CAGCCCTTAA TAAGTGCCCA
TGGAGGGGGG AATCTTTCTG GCCTTGTAAA TCGTAATCCA AATGTAGTAC CTTCTCAAGG GATCAGTACT TTTCATACTC
CAAATAATCC ATATTTGGTT AGTCCAAATT CTATGGGAAT GGGCTCCAAA CAACCACCTG GTGTTCTTAA GACAGAAAAC
TCTGACGCTC TGAACCATAG CTATGGTTAT CTTGGTGGTA GCAACCCCCC TATGGACTCT GGCTTACTCT CTTCACAATC
AAAAAATACA CAGTTTGGTT TACTGGGTCA GGATGACATC ACTGGTAGCT GGTCGCCTCT GCCGAATGTT GACAGTTATG
GTAATACTGT TGGGCTAAGC CACCCTGGGT CCAGTTCATC TAGTTTTCAA AGTTCTAATG TGGCTCTTGG GAAATTGCCT
GATCAAGGGC GAGGAAAGAA TCATGGATTT GTTGGTAAAG GTACTTGCAT TCCAAGCCGC TTTGCAGTGG ATGAGATTGA
ATCTCCAACT AACAACTTGA GTCACAGCAT TGGAAGCAGT GGAGATATTA TGAGCCCTGA TATTTTCGGA TTTAGTGGAC
AGATGTGAAG GCTTCTTGAA TTTGTAAGTA GGTAGGTACA ATATCCTAAT TTTGGTAGCA GATAGCTTTG GTGTTCTTAC
CCCAAATATT GCTTTAATGC ATTTTGTCCT CTCTATAATG TGATCGTCTC TACCTAGTGA TCCCATCAAT TTTGGCATAT
CATTCATGTT GCTTCTTTGG ACAATAGTAG ACCTTGGTTA TGTTTCAAGC TATGAACACC TTGATGGCTT GGTTGCTATA
TTTATTTTAC CTCGCGCATT TGTTATGGAG TATTTGATTT GTTATGCCTA TGGTAATTTA GCGAACTAGC AGTATGTTCT
TCGTGAGTCA TGTTCATAAT TGATATTTCA AGTTGACTGT ACCTTTTGCC TTTTATGCAA AAACATTGTT TAATTGTGCA
ATTACCGAAA CCTCATTTTT CTAATGGCAT TGTTTATTTG TTTATGCAGG GTAATCACTG GAAACAATTT TTAGTGGGTT
GATGAACGGT TGCCGTGTTT TTCATTTCAT CCTTTTTTTT TTCCTTCTGT AATTGGTTTA TAAAGGGAAT AATTTATGTG
ACAGCATGTC GAATCTTGGT TTATAGAAGG TTGTTCGGTT TAAACAACTT TGGATTATTT AGCCTCATGT GACATAGCTC
ATTTTCCTTT GTTCATTTTT TGTGTACAGT TTTCTGATTT TGTTGCAAAT CTTCTTCTCT C

Locus: Os03g0224200

Loading...

Locus: Os03g0224200

Loading...