Os03t0224200-02

Locus

Os03g0224200

Description

B-type response regulator, Cytokinin signaling

RAP-DB Gene Symbol Synonym(s)

ORR1, ORR1, Orr1, OsRR21, Rrb1, OsRR19, OsRRB1

RAP-DB Gene Name Synonym(s)

B-TYPE RESPONSE REGULATOR 1, B-type response regulator 1, B-type RR 1

CGSNL Gene Symbol

RR21

CGSNL Gene Name

B-TYPE RESPONSE REGULATOR 1

Oryzabase Gene Symbol Synonym(s)

OsRR21, Rrb1, Orr1, OsRR19, OsRRB1, ORR1

Oryzabase Gene Name Synonym(s)

B-type response regulator 1, B-type RR 1, ORYZA SATIVA RESPONSE REGULATOR 1

Transcript Evidence

AB246780 (DDBJ)

Protein Evidence

Q8H7S7 (UniProt)

Literature

PMID: 16919402

PMID: 17293362

Note

Manual Curation

May 20, 2010

Gene Ontology (GO)

Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: two-component response regulator activity (GO:0000156)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

SANT/Myb domain (IPR001005)

Signal transduction response regulator, receiver domain (IPR001789)

Myb DNA-binding domain, plants (IPR006447)

Homeodomain-like (IPR009057)

CheY-like superfamily (IPR011006)

Response regulator, plant B-type (IPR017053)

Myb domain, DNA-binding (IPR017930)

Expression Databases

TENOR (Os03t0224200-02)

Others

Oryzabase (8148)

Transcript

2364 bp

>Os03t0224200-02 B-type response regulator, Cytokinin signaling
GGTTGGATCTGCTTGCCTTGATGGTGGCGATTGGAGCGTGAATTCGTGAGGGGGGCGTGG
TGGTGGTGGTGGTGGTTATACGGTTTTCGGTTTCGTGGGCGGGGGAGAGATGGCGCCGGT
GGAGGATGGCGGCGGGGTGGAGTTCCCCGTGGGGATGAAGGTGCTGGTGGTGGACGACGA
CCCTACATGCCTCGCCGTGCTCAAGAGGATGCTCCTCGAGTGCCGCTACGACGCGACAAC
TTGTTCTCAGGCTACAAGAGCATTAACTATGCTGCGAGAGAACAGGCGTGGTTTTGATGT
TATAATTAGCGATGTTCATATGCCTGATATGGACGGATTCAGGTTACTTGAACTTGTTGG
CCTTGAGATGGATCTCCCAGTTATTATGATGTCTGCTGATTCAAGGACAGATATCGTTAT
GAAAGGAATAAAACATGGAGCATGTGACTACTTAATTAAACCCGTCAGAATGGAGGAGTT
GAAGAACATCTGGCAACATGTTATAAGGAAAAAGTTTAATGAAAACAAGGAGCATGAGCA
TTCAGGTAGCCTAGATGATACAGATCGTACCAGACCAACCAATAACGATAATGAGTATGC
TTCATCTGCAAATGATGGAGCTGAAGGTAGCTGGAAGTCTCAGAAAAAGAAACGGGATAA
AGATGATGACGATGGTGAATTGGAAAGTGGTGACCCTTCTTCTACATCAAAGAAACCAAG
AGTTGTTTGGTCAGTTGAACTCCACCAACAATTTGTAAACGCAGTTAATCATCTGGGGAT
AGACAAAGCTGTTCCCAAGAAAATTTTGGAGTTGATGAATGTTCCTGGTTTAACTAGGGA
AAATGTCGCCAGCCATTTGCAGAAGTTCAGATTGTATCTGAAGAGGATTGCTCAGCATCA
TGCCGGAATAGCTAATCCATTCTGCCCGCCTGCTTCTAGTGGTAAAGTAGGCTCACTGGG
AGGACTTGATTTCCAAGCTTTGGCTGCCTCAGGTCAGATCCCTCCTCAAGCCCTGGCCGC
CTTGCAGGATGAGCTCCTAGGGCGACCTACAAATAGTTTGGTATTGCCTGGAAGGGACCA
GTCATCTTTACGGCTTGCTGCAGTCAAAGGAAACAAGCCCCATGGGGAGAGAGAAATAGC
ATTTGGTCAACCTATATACAAGTGCCAGAATAATGCATATGGGGCATTCCCTCAAAGCAG
TCCAGCTGTTGGAGGAATGCCTTCATTTTCAGCTTGGCCCAATAACAAACTTGGTATGGC
AGACTCAACCGGCACATTGGGAGGCATGAGTAATTCTCAGAATAGCAATATAGTCTTGCA
TGAATTGCAACAGCAGCCAGATGCCATGCTGTCAGGAACCCTTCACTCTCTAGATGTCAA
ACCTTCTGGGATAGTTATGCCTTCTCAGTCATTAAATACTTTCTCAGCCAGTGAGGGTCT
CTCCCCTAATCAAAATACCTTGATGATACCTGCTCAGTCATCTGGTTTTCTAGCGGCCAT
GCCTCCATCCATGAAGCATGAACCTGTTCTTGCAACTTCTCAACCATCGAGTAGTCTGTT
AGGTGGTATTGATTTGGTTAATCAAGCTTCAACAAGTCAGCCCTTAATAAGTGCCCATGG
AGGGGGGAATCTTTCTGGCCTTGTAAATCGTAATCCAAATGTAGTACCTTCTCAAGGGAT
CAGTACTTTTCATACTCCAAATAATCCATATTTGGTTAGTCCAAATTCTATGGGAATGGG
CTCCAAACAACCACCTGGTGTTCTTAAGACAGAAAACTCTGACGCTCTGAACCATAGCTA
TGGTTATCTTGGTGGTAGCAACCCCCCTATGGACTCTGGCTTACTCTCTTCACAATCAAA
AAATACACAGTTTGGTTTACTGGGTCAGGATGACATCACTGGTAGCTGGTCGCCTCTGCC
GAATGTTGACAGTTATGGTAATACTGTTGGGCTAAGCCACCCTGGGTCCAGTTCATCTAG
TTTTCAAAGTTCTAATGTGGCTCTTGGGAAATTGCCTGATCAAGGGCGAGGAAAGAATCA
TGGATTTGTTGGTAAAGGTACTTGCATTCCAAGCCGCTTTGCAGTGGATGAGATTGAATC
TCCAACTAACAACTTGAGTCACAGCATTGGAAGCAGTGGAGATATTATGAGCCCTGATAT
TTTCGGATTTAGTGGACAGATGTGAAGGCTTCTTGAATTTGTAAGTAGGGTAATCACTGG
AAACAATTTTTAGTGGGTTGATGAACGGTTGCCGTGTTTTTCATTTCATCCTTTTTTTTT
TCCTTCTGTAATTGGTTTATAAAGGGAATAATTTATGTGACAGCATGTCGAATCTTGGTT
TATAGAAGGTTGTTCGGTTTAAAC

CDS

2076 bp

>Os03t0224200-02 B-type response regulator, Cytokinin signaling
ATGGCGCCGGTGGAGGATGGCGGCGGGGTGGAGTTCCCCGTGGGGATGAAGGTGCTGGTG
GTGGACGACGACCCTACATGCCTCGCCGTGCTCAAGAGGATGCTCCTCGAGTGCCGCTAC
GACGCGACAACTTGTTCTCAGGCTACAAGAGCATTAACTATGCTGCGAGAGAACAGGCGT
GGTTTTGATGTTATAATTAGCGATGTTCATATGCCTGATATGGACGGATTCAGGTTACTT
GAACTTGTTGGCCTTGAGATGGATCTCCCAGTTATTATGATGTCTGCTGATTCAAGGACA
GATATCGTTATGAAAGGAATAAAACATGGAGCATGTGACTACTTAATTAAACCCGTCAGA
ATGGAGGAGTTGAAGAACATCTGGCAACATGTTATAAGGAAAAAGTTTAATGAAAACAAG
GAGCATGAGCATTCAGGTAGCCTAGATGATACAGATCGTACCAGACCAACCAATAACGAT
AATGAGTATGCTTCATCTGCAAATGATGGAGCTGAAGGTAGCTGGAAGTCTCAGAAAAAG
AAACGGGATAAAGATGATGACGATGGTGAATTGGAAAGTGGTGACCCTTCTTCTACATCA
AAGAAACCAAGAGTTGTTTGGTCAGTTGAACTCCACCAACAATTTGTAAACGCAGTTAAT
CATCTGGGGATAGACAAAGCTGTTCCCAAGAAAATTTTGGAGTTGATGAATGTTCCTGGT
TTAACTAGGGAAAATGTCGCCAGCCATTTGCAGAAGTTCAGATTGTATCTGAAGAGGATT
GCTCAGCATCATGCCGGAATAGCTAATCCATTCTGCCCGCCTGCTTCTAGTGGTAAAGTA
GGCTCACTGGGAGGACTTGATTTCCAAGCTTTGGCTGCCTCAGGTCAGATCCCTCCTCAA
GCCCTGGCCGCCTTGCAGGATGAGCTCCTAGGGCGACCTACAAATAGTTTGGTATTGCCT
GGAAGGGACCAGTCATCTTTACGGCTTGCTGCAGTCAAAGGAAACAAGCCCCATGGGGAG
AGAGAAATAGCATTTGGTCAACCTATATACAAGTGCCAGAATAATGCATATGGGGCATTC
CCTCAAAGCAGTCCAGCTGTTGGAGGAATGCCTTCATTTTCAGCTTGGCCCAATAACAAA
CTTGGTATGGCAGACTCAACCGGCACATTGGGAGGCATGAGTAATTCTCAGAATAGCAAT
ATAGTCTTGCATGAATTGCAACAGCAGCCAGATGCCATGCTGTCAGGAACCCTTCACTCT
CTAGATGTCAAACCTTCTGGGATAGTTATGCCTTCTCAGTCATTAAATACTTTCTCAGCC
AGTGAGGGTCTCTCCCCTAATCAAAATACCTTGATGATACCTGCTCAGTCATCTGGTTTT
CTAGCGGCCATGCCTCCATCCATGAAGCATGAACCTGTTCTTGCAACTTCTCAACCATCG
AGTAGTCTGTTAGGTGGTATTGATTTGGTTAATCAAGCTTCAACAAGTCAGCCCTTAATA
AGTGCCCATGGAGGGGGGAATCTTTCTGGCCTTGTAAATCGTAATCCAAATGTAGTACCT
TCTCAAGGGATCAGTACTTTTCATACTCCAAATAATCCATATTTGGTTAGTCCAAATTCT
ATGGGAATGGGCTCCAAACAACCACCTGGTGTTCTTAAGACAGAAAACTCTGACGCTCTG
AACCATAGCTATGGTTATCTTGGTGGTAGCAACCCCCCTATGGACTCTGGCTTACTCTCT
TCACAATCAAAAAATACACAGTTTGGTTTACTGGGTCAGGATGACATCACTGGTAGCTGG
TCGCCTCTGCCGAATGTTGACAGTTATGGTAATACTGTTGGGCTAAGCCACCCTGGGTCC
AGTTCATCTAGTTTTCAAAGTTCTAATGTGGCTCTTGGGAAATTGCCTGATCAAGGGCGA
GGAAAGAATCATGGATTTGTTGGTAAAGGTACTTGCATTCCAAGCCGCTTTGCAGTGGAT
GAGATTGAATCTCCAACTAACAACTTGAGTCACAGCATTGGAAGCAGTGGAGATATTATG
AGCCCTGATATTTTCGGATTTAGTGGACAGATGTGA

Protein

692 aa

>Os03t0224200-02 B-type response regulator, Cytokinin signaling
MAPVEDGGGVEFPVGMKVLVVDDDPTCLAVLKRMLLECRYDATTCSQATRALTMLRENRR
GFDVIISDVHMPDMDGFRLLELVGLEMDLPVIMMSADSRTDIVMKGIKHGACDYLIKPVR
MEELKNIWQHVIRKKFNENKEHEHSGSLDDTDRTRPTNNDNEYASSANDGAEGSWKSQKK
KRDKDDDDGELESGDPSSTSKKPRVVWSVELHQQFVNAVNHLGIDKAVPKKILELMNVPG
LTRENVASHLQKFRLYLKRIAQHHAGIANPFCPPASSGKVGSLGGLDFQALAASGQIPPQ
ALAALQDELLGRPTNSLVLPGRDQSSLRLAAVKGNKPHGEREIAFGQPIYKCQNNAYGAF
PQSSPAVGGMPSFSAWPNNKLGMADSTGTLGGMSNSQNSNIVLHELQQQPDAMLSGTLHS
LDVKPSGIVMPSQSLNTFSASEGLSPNQNTLMIPAQSSGFLAAMPPSMKHEPVLATSQPS
SSLLGGIDLVNQASTSQPLISAHGGGNLSGLVNRNPNVVPSQGISTFHTPNNPYLVSPNS
MGMGSKQPPGVLKTENSDALNHSYGYLGGSNPPMDSGLLSSQSKNTQFGLLGQDDITGSW
SPLPNVDSYGNTVGLSHPGSSSSSFQSSNVALGKLPDQGRGKNHGFVGKGTCIPSRFAVD
EIESPTNNLSHSIGSSGDIMSPDIFGFSGQM*

5'UTR

chr03:6512918..6513026 (+ strand) : 109 bp

CDS

chr03:6513027..6513150 (+ strand) : 124 bp

chr03:6514853..6515005 (+ strand) : 153 bp

chr03:6515088..6515486 (+ strand) : 399 bp

chr03:6515664..6515740 (+ strand) : 77 bp

chr03:6516496..6517818 (+ strand) : 1323 bp

3'UTR

chr03:6517819..6517841 (+ strand) : 23 bp

chr03:6518260..6518415 (+ strand) : 156 bp

FASTA

>Os03t0224200-02 class=Sequence position=chr03:6512918..6518415 (+ strand)
GGTTGGATCT GCTTGCCTTG ATGGTGGCGA TTGGAGCGTG AATTCGTGAG GGGGGCGTGG TGGTGGTGGT GGTGGTTATA
CGGTTTTCGG TTTCGTGGGC GGGGGAGAGA TGGCGCCGGT GGAGGATGGC GGCGGGGTGG AGTTCCCCGT GGGGATGAAG
GTGCTGGTGG TGGACGACGA CCCTACATGC CTCGCCGTGC TCAAGAGGAT GCTCCTCGAG TGCCGCTACG ACGGTGAGCA
GCTCTGCCTT CGCCTCTGCC TCTCCCGCGT TCTCTGTCCT TGTAGTCTAT CGCTTGCTGT GCTGCGGTTG TGTGGGCGTG
ACATGATTGG TTGCGTGGAG GCGGTTGGTC GGATAAGTTT CGTTGTTTCG GTTAGTGTTT CGTGTTCCGA TTTGTCTGGG
GTTGGGGAGG AGTCGGCTGC TCCGTGGGTT GATTTGCTTT TCCGTGAATT CTGGGGAGTT TTTATTTTTT TTCTGCACAT
CTCCGTTATT GGGAATTTTT GCCCTTATTG TCGGTTTTCT CAATCTGGGA ATAGATTGTT GAGTTTATAT AGATTAGTGA
TTGTATTGGA GATCTGAGCG AGTTTGCGGT GTGAAATCTG AACCGTGTTG CTAATATCTA ATCCTGCCTT TTTGTTTGTG
CTAATATAAG CAGTAGTTTT TAAGATTCTT Aggccagtca caatgggggt ttcactggtg tgtcatgcac atttaatagg
ggtaagactg aataaaaaat gattatttgc atgaaatggg gatgagagag aaggaaagag tttcatcctg gtgaaactcg
tcagcgtcgt ttccaagtcc tcggtaacag agtgaaaccc ccgttgaggc cgattcgttt cattcaccgg atctcttgcg
tccgcctccg ccgtgcgacc tccgcattct cccgcgccgc gccggatttt gggtacaaat gatcccagca acttgtatca
attaaatgct ttgcttagtc ttggaaacgt caaagtgaaa cccctccact gtggggattg tttcataaaa gatttcattt
gagagaagat ggtataatat tttgggtagc cgtgcaatga cactagccat tgtgactggc cTTATATTCT GTGGATTCAT
GCGGGCTTCG AATTACTATT ATATCATCCC AACCTAAGAC TTGCAATATA TTGGGAATAT ATCGTCGATG CTCCTAGCTT
TTGTTCCCTA TCCCGATAAC ATTTTGTTAT GCCTAATGAC TGTGAATTAT CACCCATAGT AATGACTGCA AATTATCACG
GAAAGTTTAG CTTAGGATCA GGAGTTTATT AGAGGCGCTA TGCATCACCC ACCTACCCCA CAGTTAAGTT TTGTTGCAAC
AGGAACGAAT ACTCCAAGGA TGCAATGCGG CATATCTAGG TTGCAGCCTA TATAGAATCT TTGTTCTGTA AAGTGTTGCT
ATTCCTTTCT AGTTTCTGTT CTGGGCGCCA ATAGTTCACA TATGCGCATC ACAGCTTAGG GGAAATAACA AATAATATAA
TGGGTTTATT ACTGATCTAT TTTTTCTTAT TATATTACAG TTGATTTATT TCCTACTATA AGTTGAATGT GTGCAGCATG
AGAAACTGTT GGATTTTATT CCTTATCCAG TCTTCTCTAT TGAATGATCT CTGCTTTAAA ACGAACGTGA AAAGCATTAG
GCATACCCAT GGAGGTATTC AGTATTCATA ATGTAATGCA ATTGTACATA AATATCATCT GCTGCTTTTA TGCCTTCAAA
TACACTTTTA AGTTTATATC ATGTTGTGTG CAGTACTTTT TCGTTGCTTT GTTTTGTTTT CACTCTGTTG TTTCCGAAAA
TTCCACTCGT TCGTGGGAAG CTAATATCGT AATTTGCATC TGCTTCATTT GTATGTCTGA ATAGTTATTT TGTTTACTTT
GTTTTTTTTG GGCAGCGACA ACTTGTTCTC AGGCTACAAG AGCATTAACT ATGCTGCGAG AGAACAGGCG TGGTTTTGAT
GTTATAATTA GCGATGTTCA TATGCCTGAT ATGGACGGAT TCAGGTTACT TGAACTTGTT GGCCTTGAGA TGGATCTCCC
AGTTATTAGT AAGTAGATTA ATATTCTCCA CCCTGCTTGT TAATTCTGGT TTGTCAAAGG CATTACTGAA ATCTGTTGAT
AATATTGCAG TGATGTCTGC TGATTCAAGG ACAGATATCG TTATGAAAGG AATAAAACAT GGAGCATGTG ACTACTTAAT
TAAACCCGTC AGAATGGAGG AGTTGAAGAA CATCTGGCAA CATGTTATAA GGAAAAAGTT TAATGAAAAC AAGGAGCATG
AGCATTCAGG TAGCCTAGAT GATACAGATC GTACCAGACC AACCAATAAC GATAATGAGT ATGCTTCATC TGCAAATGAT
GGAGCTGAAG GTAGCTGGAA GTCTCAGAAA AAGAAACGGG ATAAAGATGA TGACGATGGT GAATTGGAAA GTGGTGACCC
TTCTTCTACA TCAAAGAAAC CAAGAGTTGT TTGGTCAGTT GAACTCCACC AACAATTTGT AAACGCAGTT AATCATCTGG
GGATAGACAG TAAGTTTTTC CTACTTTTGG CACTTATTTT CATCAACAGC AATGTTTGGT CGGCTGTACA CTTGCTAATT
TATTTTTCTT TTGGTGTTGT TTACCACATT TGAACACCTG AACCTTGCAA TTACATCAAA TCTTTCCGCT TTCAAGCTTA
CACAAATTTT ATAATTTTCT CTTCAGAAGC TGTTCCCAAG AAAATTTTGG AGTTGATGAA TGTTCCTGGT TTAACTAGGG
AAAATGTCGC CAGCCATTTG CAGGTTTGAT TCTGGTTTTC ATTTTTAATC ACGGGTCCTT TTTCTTGTAT CATATTTAGC
ATGGTGTGGT GGATGTTATG TTTACTGGCA CCATGGAATA TCTACCCTTT TGTATTATCC TAATTGTTAT TATTCGTATT
TATTTTACAC ATCCTTGCTC TACCTGAATG TATCTACTCT GATTTAATTA GCAGTAGAAA CCAACTAACC AAAGGACTTG
CTCCTGGAAT GATCTTGTAA TTCCAGGGAC TTGTACATAC ACTATTTTAG TGCTGTTACA CTCTTTTATT GTAGAATGAA
ACCATACCAA ATTATAGATC ATTCAACCAG TGCAGATGGC AACGAATCGC TCTATAATAG ATGTTTGATA ATAAACATTG
TTTTTCTGTT GTTCTTATTG TGTTGCCTGG GGATCATCCA TTTGAAGGTT TTGTCTACAG AGTAAAATTC CATTGGTTAC
CTTGTGCATT TGTGCTGCTT GTCTGTTGAG CTCCAATCTC CCTGTTACCT TCATTTTTTT AATATATACC AGGACCTGTT
TAAGTGCTTA GTTCAATAGT CATGATATAC AGTAGCTTAG ACCCTGTTTG AACTCAGGAC GTCCCTAAGT TATCTTGAAA
CAATGTCGTT TTTCTTGGGC ATATTGAAGT TGCTGAAACA GTAATGAAGT ATCTGTTTGC TCTTGCTGTA ACTTCCAGTT
TTTTAGTTAT GTAATGATAA TCATGGTGAT GCAATGAGTT TTTTTTTTCT ATTTTCAGAA GTTCAGATTG TATCTGAAGA
GGATTGCTCA GCATCATGCC GGAATAGCTA ATCCATTCTG CCCGCCTGCT TCTAGTGGTA AAGTAGGCTC ACTGGGAGGA
CTTGATTTCC AAGCTTTGGC TGCCTCAGGT CAGATCCCTC CTCAAGCCCT GGCCGCCTTG CAGGATGAGC TCCTAGGGCG
ACCTACAAAT AGTTTGGTAT TGCCTGGAAG GGACCAGTCA TCTTTACGGC TTGCTGCAGT CAAAGGAAAC AAGCCCCATG
GGGAGAGAGA AATAGCATTT GGTCAACCTA TATACAAGTG CCAGAATAAT GCATATGGGG CATTCCCTCA AAGCAGTCCA
GCTGTTGGAG GAATGCCTTC ATTTTCAGCT TGGCCCAATA ACAAACTTGG TATGGCAGAC TCAACCGGCA CATTGGGAGG
CATGAGTAAT TCTCAGAATA GCAATATAGT CTTGCATGAA TTGCAACAGC AGCCAGATGC CATGCTGTCA GGAACCCTTC
ACTCTCTAGA TGTCAAACCT TCTGGGATAG TTATGCCTTC TCAGTCATTA AATACTTTCT CAGCCAGTGA GGGTCTCTCC
CCTAATCAAA ATACCTTGAT GATACCTGCT CAGTCATCTG GTTTTCTAGC GGCCATGCCT CCATCCATGA AGCATGAACC
TGTTCTTGCA ACTTCTCAAC CATCGAGTAG TCTGTTAGGT GGTATTGATT TGGTTAATCA AGCTTCAACA AGTCAGCCCT
TAATAAGTGC CCATGGAGGG GGGAATCTTT CTGGCCTTGT AAATCGTAAT CCAAATGTAG TACCTTCTCA AGGGATCAGT
ACTTTTCATA CTCCAAATAA TCCATATTTG GTTAGTCCAA ATTCTATGGG AATGGGCTCC AAACAACCAC CTGGTGTTCT
TAAGACAGAA AACTCTGACG CTCTGAACCA TAGCTATGGT TATCTTGGTG GTAGCAACCC CCCTATGGAC TCTGGCTTAC
TCTCTTCACA ATCAAAAAAT ACACAGTTTG GTTTACTGGG TCAGGATGAC ATCACTGGTA GCTGGTCGCC TCTGCCGAAT
GTTGACAGTT ATGGTAATAC TGTTGGGCTA AGCCACCCTG GGTCCAGTTC ATCTAGTTTT CAAAGTTCTA ATGTGGCTCT
TGGGAAATTG CCTGATCAAG GGCGAGGAAA GAATCATGGA TTTGTTGGTA AAGGTACTTG CATTCCAAGC CGCTTTGCAG
TGGATGAGAT TGAATCTCCA ACTAACAACT TGAGTCACAG CATTGGAAGC AGTGGAGATA TTATGAGCCC TGATATTTTC
GGATTTAGTG GACAGATGTG AAGGCTTCTT GAATTTGTAA GTAGGTAGGT ACAATATCCT AATTTTGGTA GCAGATAGCT
TTGGTGTTCT TACCCCAAAT ATTGCTTTAA TGCATTTTGT CCTCTCTATA ATGTGATCGT CTCTACCTAG TGATCCCATC
AATTTTGGCA TATCATTCAT GTTGCTTCTT TGGACAATAG TAGACCTTGG TTATGTTTCA AGCTATGAAC ACCTTGATGG
CTTGGTTGCT ATATTTATTT TACCTCGCGC ATTTGTTATG GAGTATTTGA TTTGTTATGC CTATGGTAAT TTAGCGAACT
AGCAGTATGT TCTTCGTGAG TCATGTTCAT AATTGATATT TCAAGTTGAC TGTACCTTTT GCCTTTTATG CAAAAACATT
GTTTAATTGT GCAATTACCG AAACCTCATT TTTCTAATGG CATTGTTTAT TTGTTTATGC AGGGTAATCA CTGGAAACAA
TTTTTAGTGG GTTGATGAAC GGTTGCCGTG TTTTTCATTT CATCCTTTTT TTTTTCCTTC TGTAATTGGT TTATAAAGGG
AATAATTTAT GTGACAGCAT GTCGAATCTT GGTTTATAGA AGGTTGTTCG GTTTAAAC

Locus: Os03g0224200

Loading...

Locus: Os03g0224200

Loading...