Os03t0224200-03

Locus

Os03g0224200

Description

Similar to response regulator 8.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RR21

CGSNL Gene Name

B-TYPE RESPONSE REGULATOR 1

Oryzabase Gene Symbol Synonym(s)

OsRR21, Rrb1, Orr1, OsRR19, OsRRB1, ORR1

Oryzabase Gene Name Synonym(s)

B-type response regulator 1, B-type RR 1, ORYZA SATIVA RESPONSE REGULATOR 1

Transcript Evidence

AK112039 (DDBJ, Best hit)

Protein Evidence

NP_001104861.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Myb-like DNA-binding domain, SHAQKYF class (IPR006447)

Homeodomain-like (IPR009057)

Homeodomain-related (IPR012287)

Full-length cDNA

001-044-C11 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0224200-03)

RiceXPro (AK112039)

Others

Oryzabase (8148)

Transcript

1590 bp

>Os03t0224200-03 Similar to response regulator 8.
AAGCTGTTCCCAAGAAAATTTTGGAGTTGATGAATGTTCCTGGTTTAACTAGGGAAAATG
TCGCCAGCCATTTGCAGAAGTTCAGATTGTATCTGAAGAGGATTGCTCAGCATCATGCCG
GAATAGCTAATCCATTCTGCCCGCCTGCTTCTAGTGGTAAAGTAGGCTCACTGGGAGGAC
TTGATTTCCAAGCTTTGGCTGCCTCAGGTCAGATCCCTCCTCAAGCCCTGGCCGCCTTGC
AGGATGAGCTCCTAGGGCGACCTACAAATAGTTTGGTATTGCCTGGAAGGGACCAGTCAT
CTTTACGGCTTGCTGCAGTCAAAGGAAACAAGCCCCATGGGGAGAGAGAAATAGCATTTG
GTCAACCTATATACAAGTGCCAGAATAATGCATATGGGGCATTCCCTCAAAGCAGTCCAG
CTGTTGGAGGAATGCCTTCATTTTCAGCTTGGCCCAATAACAAACTTGGTATGGCAGACT
CAACCGGCACATTGGGAGGCATGAGTAATTCTCAGAATAGCAATATAGTCTTGCATGAAT
TGCAACAGCAGCCAGATGCCATGCTGTCAGGAACCCTTCACTCTCTAGATGTCAAACCTT
CTGGGATAGTTATGCCTTCTCAGTCATTAAATACTTTCTCAGCCAGTGAGGGTCTCTCCC
CTAATCAAAATACCTTGATGATACCTGCTCAGTCATCTGGTTTTCTAGCGGCCATGCCTC
CATCCATGAAGCATGAACCTGTTCTTGCAACTTCTCAACCATCGAGTAGTCTGTTAGGTG
GTATTGATTTGGTTAATCAAGCTTCAACAAGTCAGCCCTTAATAAGTGCCCATGGAGGGG
GGAATCTTTCTGGCCTTGTAAATCGTAATCCAAATGTAGTACCTTCTCAAGGGATCAGTA
CTTTTCATACTCCAAATAATCCATATTTGGTTAGTCCAAATTCTATGGGAATGGGCTCCA
AACAACCACCTGGTGTTCTTAAGACAGAAAACTCTGACGCTCTGAACCATAGCTATGGTT
ATCTTGGTGGTAGCAACCCCCCTATGGACTCTGGCTTACTCTCTTCACAATCAAAAAATA
CACAGTTTGGTTTACTGGGTCAGGATGACATCACTGGTAGCTGGTCGCCTCTGCCGAATG
TTGACAGTTATGGTAATACTGTTGGGCTAAGCCACCCTGGGTCCAGTTCATCTAGTTTTC
AAAGTTCTAATGTGGCTCTTGGGAAATTGCCTGATCAAGGGCGAGGAAAGAATCATGGAT
TTGTTGGTAAAGGTACTTGCATTCCAAGCCGCTTTGCAGTGGATGAGATTGAATCTCCAA
CTAACAACTTGAGTCACAGCATTGGAAGCAGTGGAGATATTATGAGCCCTGATATTTTCG
GATTTAGTGGACAGATGTGAAGGCTTCTTGAATTTGTAAGTAGGGTAATCACTGGAAACA
ATTTTTAGTGGGTTGATGAACGGTTGCCGTGTTTTTCATTTCATCCTTTTTTTTTTCCTT
CTGTAATTGGTTTATAAAGGGAATAATTTATGTGACAGCATGTCGAATCTTGGTTTATAG
AAGGTTGTTCGGTTTAAACAACTTTGGATT

CDS

1398 bp

>Os03t0224200-03 Similar to response regulator 8.
GCTGTTCCCAAGAAAATTTTGGAGTTGATGAATGTTCCTGGTTTAACTAGGGAAAATGTC
GCCAGCCATTTGCAGAAGTTCAGATTGTATCTGAAGAGGATTGCTCAGCATCATGCCGGA
ATAGCTAATCCATTCTGCCCGCCTGCTTCTAGTGGTAAAGTAGGCTCACTGGGAGGACTT
GATTTCCAAGCTTTGGCTGCCTCAGGTCAGATCCCTCCTCAAGCCCTGGCCGCCTTGCAG
GATGAGCTCCTAGGGCGACCTACAAATAGTTTGGTATTGCCTGGAAGGGACCAGTCATCT
TTACGGCTTGCTGCAGTCAAAGGAAACAAGCCCCATGGGGAGAGAGAAATAGCATTTGGT
CAACCTATATACAAGTGCCAGAATAATGCATATGGGGCATTCCCTCAAAGCAGTCCAGCT
GTTGGAGGAATGCCTTCATTTTCAGCTTGGCCCAATAACAAACTTGGTATGGCAGACTCA
ACCGGCACATTGGGAGGCATGAGTAATTCTCAGAATAGCAATATAGTCTTGCATGAATTG
CAACAGCAGCCAGATGCCATGCTGTCAGGAACCCTTCACTCTCTAGATGTCAAACCTTCT
GGGATAGTTATGCCTTCTCAGTCATTAAATACTTTCTCAGCCAGTGAGGGTCTCTCCCCT
AATCAAAATACCTTGATGATACCTGCTCAGTCATCTGGTTTTCTAGCGGCCATGCCTCCA
TCCATGAAGCATGAACCTGTTCTTGCAACTTCTCAACCATCGAGTAGTCTGTTAGGTGGT
ATTGATTTGGTTAATCAAGCTTCAACAAGTCAGCCCTTAATAAGTGCCCATGGAGGGGGG
AATCTTTCTGGCCTTGTAAATCGTAATCCAAATGTAGTACCTTCTCAAGGGATCAGTACT
TTTCATACTCCAAATAATCCATATTTGGTTAGTCCAAATTCTATGGGAATGGGCTCCAAA
CAACCACCTGGTGTTCTTAAGACAGAAAACTCTGACGCTCTGAACCATAGCTATGGTTAT
CTTGGTGGTAGCAACCCCCCTATGGACTCTGGCTTACTCTCTTCACAATCAAAAAATACA
CAGTTTGGTTTACTGGGTCAGGATGACATCACTGGTAGCTGGTCGCCTCTGCCGAATGTT
GACAGTTATGGTAATACTGTTGGGCTAAGCCACCCTGGGTCCAGTTCATCTAGTTTTCAA
AGTTCTAATGTGGCTCTTGGGAAATTGCCTGATCAAGGGCGAGGAAAGAATCATGGATTT
GTTGGTAAAGGTACTTGCATTCCAAGCCGCTTTGCAGTGGATGAGATTGAATCTCCAACT
AACAACTTGAGTCACAGCATTGGAAGCAGTGGAGATATTATGAGCCCTGATATTTTCGGA
TTTAGTGGACAGATGTGA

Protein

466 aa

>Os03t0224200-03 Similar to response regulator 8.
AVPKKILELMNVPGLTRENVASHLQKFRLYLKRIAQHHAGIANPFCPPASSGKVGSLGGL
DFQALAASGQIPPQALAALQDELLGRPTNSLVLPGRDQSSLRLAAVKGNKPHGEREIAFG
QPIYKCQNNAYGAFPQSSPAVGGMPSFSAWPNNKLGMADSTGTLGGMSNSQNSNIVLHEL
QQQPDAMLSGTLHSLDVKPSGIVMPSQSLNTFSASEGLSPNQNTLMIPAQSSGFLAAMPP
SMKHEPVLATSQPSSSLLGGIDLVNQASTSQPLISAHGGGNLSGLVNRNPNVVPSQGIST
FHTPNNPYLVSPNSMGMGSKQPPGVLKTENSDALNHSYGYLGGSNPPMDSGLLSSQSKNT
QFGLLGQDDITGSWSPLPNVDSYGNTVGLSHPGSSSSSFQSSNVALGKLPDQGRGKNHGF
VGKGTCIPSRFAVDEIESPTNNLSHSIGSSGDIMSPDIFGFSGQM*

5'UTR

chr03:6515664..6515665 (+ strand) : 2 bp

CDS

chr03:6515666..6515740 (+ strand) : 75 bp

chr03:6516496..6517818 (+ strand) : 1323 bp

3'UTR

chr03:6517819..6517841 (+ strand) : 23 bp

chr03:6518260..6518426 (+ strand) : 167 bp

FASTA

>Os03t0224200-03 class=Sequence position=chr03:6515664..6518426 (+ strand)
AAGCTGTTCC CAAGAAAATT TTGGAGTTGA TGAATGTTCC TGGTTTAACT AGGGAAAATG TCGCCAGCCA TTTGCAGGTT
TGATTCTGGT TTTCATTTTT AATCACGGGT CCTTTTTCTT GTATCATATT TAGCATGGTG TGGTGGATGT TATGTTTACT
GGCACCATGG AATATCTACC CTTTTGTATT ATCCTAATTG TTATTATTCG TATTTATTTT ACACATCCTT GCTCTACCTG
AATGTATCTA CTCTGATTTA ATTAGCAGTA GAAACCAACT AACCAAAGGA CTTGCTCCTG GAATGATCTT GTAATTCCAG
GGACTTGTAC ATACACTATT TTAGTGCTGT TACACTCTTT TATTGTAGAA TGAAACCATA CCAAATTATA GATCATTCAA
CCAGTGCAGA TGGCAACGAA TCGCTCTATA ATAGATGTTT GATAATAAAC ATTGTTTTTC TGTTGTTCTT ATTGTGTTGC
CTGGGGATCA TCCATTTGAA GGTTTTGTCT ACAGAGTAAA ATTCCATTGG TTACCTTGTG CATTTGTGCT GCTTGTCTGT
TGAGCTCCAA TCTCCCTGTT ACCTTCATTT TTTTAATATA TACCAGGACC TGTTTAAGTG CTTAGTTCAA TAGTCATGAT
ATACAGTAGC TTAGACCCTG TTTGAACTCA GGACGTCCCT AAGTTATCTT GAAACAATGT CGTTTTTCTT GGGCATATTG
AAGTTGCTGA AACAGTAATG AAGTATCTGT TTGCTCTTGC TGTAACTTCC AGTTTTTTAG TTATGTAATG ATAATCATGG
TGATGCAATG AGTTTTTTTT TTCTATTTTC AGAAGTTCAG ATTGTATCTG AAGAGGATTG CTCAGCATCA TGCCGGAATA
GCTAATCCAT TCTGCCCGCC TGCTTCTAGT GGTAAAGTAG GCTCACTGGG AGGACTTGAT TTCCAAGCTT TGGCTGCCTC
AGGTCAGATC CCTCCTCAAG CCCTGGCCGC CTTGCAGGAT GAGCTCCTAG GGCGACCTAC AAATAGTTTG GTATTGCCTG
GAAGGGACCA GTCATCTTTA CGGCTTGCTG CAGTCAAAGG AAACAAGCCC CATGGGGAGA GAGAAATAGC ATTTGGTCAA
CCTATATACA AGTGCCAGAA TAATGCATAT GGGGCATTCC CTCAAAGCAG TCCAGCTGTT GGAGGAATGC CTTCATTTTC
AGCTTGGCCC AATAACAAAC TTGGTATGGC AGACTCAACC GGCACATTGG GAGGCATGAG TAATTCTCAG AATAGCAATA
TAGTCTTGCA TGAATTGCAA CAGCAGCCAG ATGCCATGCT GTCAGGAACC CTTCACTCTC TAGATGTCAA ACCTTCTGGG
ATAGTTATGC CTTCTCAGTC ATTAAATACT TTCTCAGCCA GTGAGGGTCT CTCCCCTAAT CAAAATACCT TGATGATACC
TGCTCAGTCA TCTGGTTTTC TAGCGGCCAT GCCTCCATCC ATGAAGCATG AACCTGTTCT TGCAACTTCT CAACCATCGA
GTAGTCTGTT AGGTGGTATT GATTTGGTTA ATCAAGCTTC AACAAGTCAG CCCTTAATAA GTGCCCATGG AGGGGGGAAT
CTTTCTGGCC TTGTAAATCG TAATCCAAAT GTAGTACCTT CTCAAGGGAT CAGTACTTTT CATACTCCAA ATAATCCATA
TTTGGTTAGT CCAAATTCTA TGGGAATGGG CTCCAAACAA CCACCTGGTG TTCTTAAGAC AGAAAACTCT GACGCTCTGA
ACCATAGCTA TGGTTATCTT GGTGGTAGCA ACCCCCCTAT GGACTCTGGC TTACTCTCTT CACAATCAAA AAATACACAG
TTTGGTTTAC TGGGTCAGGA TGACATCACT GGTAGCTGGT CGCCTCTGCC GAATGTTGAC AGTTATGGTA ATACTGTTGG
GCTAAGCCAC CCTGGGTCCA GTTCATCTAG TTTTCAAAGT TCTAATGTGG CTCTTGGGAA ATTGCCTGAT CAAGGGCGAG
GAAAGAATCA TGGATTTGTT GGTAAAGGTA CTTGCATTCC AAGCCGCTTT GCAGTGGATG AGATTGAATC TCCAACTAAC
AACTTGAGTC ACAGCATTGG AAGCAGTGGA GATATTATGA GCCCTGATAT TTTCGGATTT AGTGGACAGA TGTGAAGGCT
TCTTGAATTT GTAAGTAGGT AGGTACAATA TCCTAATTTT GGTAGCAGAT AGCTTTGGTG TTCTTACCCC AAATATTGCT
TTAATGCATT TTGTCCTCTC TATAATGTGA TCGTCTCTAC CTAGTGATCC CATCAATTTT GGCATATCAT TCATGTTGCT
TCTTTGGACA ATAGTAGACC TTGGTTATGT TTCAAGCTAT GAACACCTTG ATGGCTTGGT TGCTATATTT ATTTTACCTC
GCGCATTTGT TATGGAGTAT TTGATTTGTT ATGCCTATGG TAATTTAGCG AACTAGCAGT ATGTTCTTCG TGAGTCATGT
TCATAATTGA TATTTCAAGT TGACTGTACC TTTTGCCTTT TATGCAAAAA CATTGTTTAA TTGTGCAATT ACCGAAACCT
CATTTTTCTA ATGGCATTGT TTATTTGTTT ATGCAGGGTA ATCACTGGAA ACAATTTTTA GTGGGTTGAT GAACGGTTGC
CGTGTTTTTC ATTTCATCCT TTTTTTTTTC CTTCTGTAAT TGGTTTATAA AGGGAATAAT TTATGTGACA GCATGTCGAA
TCTTGGTTTA TAGAAGGTTG TTCGGTTTAA ACAACTTTGG ATT

Locus: Os03g0224200

Loading...

Locus: Os03g0224200

Loading...