Os03t0225200-01

Locus

Os03g0225200

Description

Meiosis specific cyclin-like protein, Meiotic double-strand break formation

RAP-DB Gene Symbol Synonym(s)

OsSDS

RAP-DB Gene Name Synonym(s)

SOLO DANCERS

CGSNL Gene Symbol

SDS

CGSNL Gene Name

SOLO DANCERS

Oryzabase Gene Symbol Synonym(s)

OsSDS, Orysa;SDS

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK074008

Protein Evidence

Q10PQ9

Literature

PMID: 25691887

Note

Manual Curation

November 19, 2020

Gene Ontology (GO)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Cyclin-like superfamily (IPR036915)

Cyclin (IPR039361)

Cyclin, N-terminal (IPR006671)

Cyclin-like (IPR013763)

Cyclin, C-terminal domain (IPR004367)

Full-length cDNA

J033078M15 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0225200-01)

RiceXPro (AK074008)

Others

Oryzabase (9119)

KEGG (Os03t0225200-01)

Transcript

2598 bp

>Os03t0225200-01 Meiosis specific cyclin-like protein, Meiotic double-strand break formation
GTAGGCCCGTAGCATCACAAATTCACAATTCACACACAAAGCACACAGCGCCGCACGCCA
ATGCCTCCTACCATGCTTGCATCGGTGCCGACGAGGCCGCGCTCCCATCCCTTCCGCCGG
CGGCGAGGCGCGGCGGCGGCGGCTCCTCCTCTGCTCCCTGATCAGATCGCGGCGGCGGCG
GCGGCGGCAGCCAAGCGACCCGCGGAGTCGTccacctcggcctcctcctgcttccacagc
gaggtcatctccgccacctccaccacctgccccacctccctcgccgcagctcAGCGCCCG
GAGAAGCGGCCTCGGTACCAGGATGTGGACGAGGAGCAGCCCGCCGCCTCCGAGTGCTCC
GAGATCATCGGTGGCGCGAGGCCGCGCGCCGCCGAGGTCGAGGTCTCCGAGTCGTCGTGC
CTCGCCTCCGTCCTCGAGTCCTACCTCGCCTGCCCCGAGCAGCTCGCCAACGACGCCGAG
ACGACCGCCTACTCCTCAGCCCGCGAGGACCTCACGCTGTCGGAGACCGAGGAGGAGGAG
GAGGAGGAGGAGGTGCGCAGTGGTCCCTGCATCTGCACCGATTGCTCGTTTAGCCCCCTT
CATGAGTCGTCCTCGTCGTCCGACGACGACAACGCCGTGCCCTCCCCCACCTTCTCCCTG
TTCCTCGCCTTGGCGGAGCAGTTCGTCCCCTTCACGCATCCCAAAACGCCCACCGCCACG
GATGTCGCTCTACAAGCGGGAGAGGGGAAGAGATTTGAGGACTTGGACAATGAGGTGAGC
TACGAGCGGTTCCGGCGGCGCGAGCGGCGAGGGGTGGTAGCCCGCGACTACATTGAGGTG
TACTCCTCCATGCTCGGCAGCTACGGCCGCGCCGTCGTGGAGCAGCGCGTTGTCATGGTG
AACTGGATCATGGAGCATTCACAAGCGATGAAGCTGCAGCCAGAGACCGTGTTCATGGGG
ATAGGGCTGATGGACCGCTTCTTGACACGTGGATATGTAAAGGGCTCTAGGAACCTGCAG
TTGCTGGGAATCGCCTGCACCACCTTGGCAACCCGCATTGAAGAGAATCAACCCTATAAT
TGCATCCTTCAAAAAGCTTTCAAAGTAGGGATCAATACTTACAGCCGAAGTGAGGTCGTC
GCCATGGAGTGGCTGGTTCAGGAGGTCCTTGACTTCCAGTGCTTTGTCACAACAACCCAT
CATTTCCTCTGGTTCTATCTGAAGGCTGCGAATGCAGATGACAGAGTCGAGGACCTGGCG
AAGTACTTGGCCTTGCTCTCACTTCTGGACCACAAACATCTCTCCTTCTGGCCCTCCACT
GTGGCAGCCGCAGTGGTAGCCCTTGCTTGCCTTGCCACAAACAATGAGTCATCATGCCAT
TTGGTTATGGAGACTCACATGAGAACGAAGAATGATGATCTGCCTGAATGCCTAATGAGT
CTCGAATGGTTGACCAATTATGCTTCCTGATTTGAACAAACCCAGGTGATATGCCGACCC
AATCTTCTGCCCATTCCCAGAAACACAGTGTAGTACGTACAGAGTCGCTTAGGAGGAGGT
GTATATAGTACACGTGCACTGTAGCTAATTCTTCGTGCATAGCATTAGTTTGACAGCAGG
GTAGAAAAGAGGGCAAAGAAGCCGGCTAAACGTGGTTGTGATGGCACCAGACTTATAGGG
AGCATCGCAACCACGAAATTTTGCTACTACTGCCGGCTTCAGTGACTACGACTAACCTCC
TGTTGTAAGCTGTCTTAAAATCAGCCTTCGTTGTGTTAAGGGCAACCAAAGGTTGAGACT
TTGTTGTTCTAATCAAACATCCTGTTTACAAATTGCAACTGGTGCCAGAATGAAATTTGT
TCTCCGGGTGGTATTGCACTGCACGAGGTTCGATTCTGTGACCCTGAAAGACGCATACTC
AGATACTCTGATGCTCAGGTTTCAGATTCTGGGATGAATAAAATGCTACTAGTAGTATCA
TCTTCTTCTGGATCTGCAAACAGATGTTCAGTTAGCTGAAGATCCAGAGTACCACCTCGT
TTGCTCAGGATGCAACAGGAAGGGTCTGCATCCAGGTGGGCTACCTGAAGTGGACGAAGC
GGTCATCTTCGTGCCGCTGCTCGAGTGGCCTAGTGGGGACCCCGGCTGCGCCCGATGCCT
CGGCCACTTTAAAAACTCGGATCGCGAGAGTTCCTGCACGCCATAAAAATGAGGAAAACG
AGAAAGAAGGGAGGGCGTTCGCGTACACCCCCCTTTCAGCCCCACTTGCGCCCGCGCTCT
CGTTGAGCCGTCTGCCTTTTGGGGTTCTAGAGTGAATAGGGTCGGCACGTTAGCGGCGAG
CCGGCGACGGGTAATGTGGTGTGCCAACAACTTTCAGCTGCTGCTGAAGTGAAGAGCAGG
TGGCGATCAACCAGTCCCGGCACTGAACTACTGAACCTGAAGTGGTTACTCCATTCATCG
ACAGAGATATTTAATTATTTGTCACTTTTAGATGTAATATTTTACCACATAAACCTACAA
ATCATAAACATATAAGTGACAAATTATTTAACGCCACATCGAAAAATGGTAAATGCTTAT
TTGCCCCTTCCCACTCTC

CDS

1410 bp

>Os03t0225200-01 Meiosis specific cyclin-like protein, Meiotic double-strand break formation
ATGCCTCCTACCATGCTTGCATCGGTGCCGACGAGGCCGCGCTCCCATCCCTTCCGCCGG
CGGCGAGGCGCGGCGGCGGCGGCTCCTCCTCTGCTCCCTGATCAGATCGCGGCGGCGGCG
GCGGCGGCAGCCAAGCGACCCGCGGAGTCGTccacctcggcctcctcctgcttccacagc
gaggtcatctccgccacctccaccacctgccccacctccctcgccgcagctcAGCGCCCG
GAGAAGCGGCCTCGGTACCAGGATGTGGACGAGGAGCAGCCCGCCGCCTCCGAGTGCTCC
GAGATCATCGGTGGCGCGAGGCCGCGCGCCGCCGAGGTCGAGGTCTCCGAGTCGTCGTGC
CTCGCCTCCGTCCTCGAGTCCTACCTCGCCTGCCCCGAGCAGCTCGCCAACGACGCCGAG
ACGACCGCCTACTCCTCAGCCCGCGAGGACCTCACGCTGTCGGAGACCGAGGAGGAGGAG
GAGGAGGAGGAGGTGCGCAGTGGTCCCTGCATCTGCACCGATTGCTCGTTTAGCCCCCTT
CATGAGTCGTCCTCGTCGTCCGACGACGACAACGCCGTGCCCTCCCCCACCTTCTCCCTG
TTCCTCGCCTTGGCGGAGCAGTTCGTCCCCTTCACGCATCCCAAAACGCCCACCGCCACG
GATGTCGCTCTACAAGCGGGAGAGGGGAAGAGATTTGAGGACTTGGACAATGAGGTGAGC
TACGAGCGGTTCCGGCGGCGCGAGCGGCGAGGGGTGGTAGCCCGCGACTACATTGAGGTG
TACTCCTCCATGCTCGGCAGCTACGGCCGCGCCGTCGTGGAGCAGCGCGTTGTCATGGTG
AACTGGATCATGGAGCATTCACAAGCGATGAAGCTGCAGCCAGAGACCGTGTTCATGGGG
ATAGGGCTGATGGACCGCTTCTTGACACGTGGATATGTAAAGGGCTCTAGGAACCTGCAG
TTGCTGGGAATCGCCTGCACCACCTTGGCAACCCGCATTGAAGAGAATCAACCCTATAAT
TGCATCCTTCAAAAAGCTTTCAAAGTAGGGATCAATACTTACAGCCGAAGTGAGGTCGTC
GCCATGGAGTGGCTGGTTCAGGAGGTCCTTGACTTCCAGTGCTTTGTCACAACAACCCAT
CATTTCCTCTGGTTCTATCTGAAGGCTGCGAATGCAGATGACAGAGTCGAGGACCTGGCG
AAGTACTTGGCCTTGCTCTCACTTCTGGACCACAAACATCTCTCCTTCTGGCCCTCCACT
GTGGCAGCCGCAGTGGTAGCCCTTGCTTGCCTTGCCACAAACAATGAGTCATCATGCCAT
TTGGTTATGGAGACTCACATGAGAACGAAGAATGATGATCTGCCTGAATGCCTAATGAGT
CTCGAATGGTTGACCAATTATGCTTCCTGA

Protein

470 aa

>Os03t0225200-01 Meiosis specific cyclin-like protein, Meiotic double-strand break formation
MPPTMLASVPTRPRSHPFRRRRGAAAAAPPLLPDQIAAAAAAAAKRPAESSTSASSCFHS
EVISATSTTCPTSLAAAQRPEKRPRYQDVDEEQPAASECSEIIGGARPRAAEVEVSESSC
LASVLESYLACPEQLANDAETTAYSSAREDLTLSETEEEEEEEEVRSGPCICTDCSFSPL
HESSSSSDDDNAVPSPTFSLFLALAEQFVPFTHPKTPTATDVALQAGEGKRFEDLDNEVS
YERFRRRERRGVVARDYIEVYSSMLGSYGRAVVEQRVVMVNWIMEHSQAMKLQPETVFMG
IGLMDRFLTRGYVKGSRNLQLLGIACTTLATRIEENQPYNCILQKAFKVGINTYSRSEVV
AMEWLVQEVLDFQCFVTTTHHFLWFYLKAANADDRVEDLAKYLALLSLLDHKHLSFWPST
VAAAVVALACLATNNESSCHLVMETHMRTKNDDLPECLMSLEWLTNYAS*

5'UTR

chr03:6561966..6562025 (- strand) : 60 bp

CDS

chr03:6561282..6561965 (- strand) : 684 bp

chr03:6561007..6561177 (- strand) : 171 bp

chr03:6559777..6559943 (- strand) : 167 bp

chr03:6558429..6558557 (- strand) : 129 bp

chr03:6558161..6558341 (- strand) : 181 bp

chr03:6557859..6557903 (- strand) : 45 bp

chr03:6557703..6557735 (- strand) : 33 bp

3'UTR

chr03:6557125..6557702 (- strand) : 578 bp

chr03:6556876..6557049 (- strand) : 174 bp

chr03:6556389..6556764 (- strand) : 376 bp

FASTA

>Os03t0225200-01 class=Sequence position=chr03:6556389..6562025 (- strand)
GTAGGCCCGT AGCATCACAA ATTCACAATT CACACACAAA GCACACAGCG CCGCACGCCA ATGCCTCCTA CCATGCTTGC
ATCGGTGCCG ACGAGGCCGC GCTCCCATCC CTTCCGCCGG CGGCGAGGCG CGGCGGCGGC GGCTCCTCCT CTGCTCCCTG
ATCAGATCGC GGCGGCGGCG GCGGCGGCAG CCAAGCGACC CGCGGAGTCG Tccacctcgg cctcctcctg cttccacagc
gaggtcatct ccgccacctc caccacctgc cccacctccc tcgccgcagc tcAGCGCCCG GAGAAGCGGC CTCGGTACCA
GGATGTGGAC GAGGAGCAGC CCGCCGCCTC CGAGTGCTCC GAGATCATCG GTGGCGCGAG GCCGCGCGCC GCCGAGGTCG
AGGTCTCCGA GTCGTCGTGC CTCGCCTCCG TCCTCGAGTC CTACCTCGCC TGCCCCGAGC AGCTCGCCAA CGACGCCGAG
ACGACCGCCT ACTCCTCAGC CCGCGAGGAC CTCACGCTGT CGGAGACCGA GGAGGAGGAG GAGGAGGAGG AGGTGCGCAG
TGGTCCCTGC ATCTGCACCG ATTGCTCGTT TAGCCCCCTT CATGAGTCGT CCTCGTCGTC CGACGACGAC AACGCCGTGC
CCTCCCCCAC CTTCTCCCTG TTCCTCGCCT TGGCGGAGCA GTTCGTCCCC TTCACGCATC CCAAAACGCC CACCGCCACG
GATGTCGCTC TACAAGCGGG AGAGGTAAGC AGGTTCCACA CAGCTTCTCT CAAATTTGTT GGAGTTTGGC TGCTCTCTCC
CGAATCAGTG CGACATTTGA TGTAATCAGA TGGGAATTAT TGTATCAGGG GAAGAGATTT GAGGACTTGG ACAATGAGGT
GAGCTACGAG CGGTTCCGGC GGCGCGAGCG GCGAGGGGTG GTAGCCCGCG ACTACATTGA GGTGTACTCC TCCATGCTCG
GCAGCTACGG CCGCGCCGTC GTGGAGCAGC GCGTTGTCAT GGTGAACTGG ATCATGGAGG TCAGTATGCT CTGCATTGTA
CACGTATGCT GCGACCATGA CTTTGCCTTG GTCCAATAAT TCATCTAGCT CGAGCGCAAT TTGTTGTGTG GTAGCTGCAG
ATGTTTGTTG CACGGGTATT GTGCTGATAA TGCACATGTA TACTTTCGGA GTGCTGTACT GATCTAGATT CTATCAGCTT
ATCTGTCTGA CTGATGTGTT CTGCAAGAAC AGTAGTTGCT TGCATTTTGC ACTAACATGC TACTCTGCAG TGTAAATGCT
GTGCTGGGTG GGAGTGCTGA GGTAGCAGAT CCGGTTGTGA TCTTGCATAT TTTGTGTAGG GGAAGCTATC TGATACCAAT
ATACGCATTG CATTTGCTGA TTCGTTTATC ACACAGTTAG CTGCCTGTAC ATTTTGCAGC ATTCCCCGTG TTAGTCTGCC
AGCAGTGTGG TGGTAATCCT AGTGATTTCA ATGTAACTCT AGTCATTAAC TTTTATGTCA TCGCATTCAA GTTCTATAGA
GCAGTGATAA AGATTTTCTA GGTGCTTATT TTGGCATGCT TGCATATTTT TTTTGGATGT AATGGCATGC TTGTATGAAA
AGAAAAGAGA TACATAGGAT TTTTCTAGGT GTTTATTTTC GCACCTGAAA GTTGCTCTGT AGTCATTTGC CATCTGAAAT
CCCATGGCAT TGGGCATTGG CATATGGCCT CCAGAAATGT CTGCATCACT TTTTACTTCT AAACCTATAT ATGCAATAAG
TGTTAGAAAA ACATATTGCC AGTGTATTCC CTTTTTTTGT GTATCCACCA TCATCTGAAT TTAATCTTTT CTAACTCTAG
TTCCATCAGT TTATATTTGC ATTGAAACTT CAGGTAGCCT TTGAAAATGA AATCGCTGTG TGTTTTTTGT TTGAAGTTTT
TTTGGGCAAC TCAGCGATAA GTACTTAAGT GATATGATCA TTTATACTTG TAATTTGATT TTTCTGAAAA TAATGTACTG
TCATTTGTGG AGAATATGTT TGTTCTTACA TAGAGTTCAT ACATAACTTG CAAAGAATGA CTTGTTCTCT ATGCATCGCT
AGCATTCACA AGCGATGAAG CTGCAGCCAG AGACCGTGTT CATGGGGATA GGGCTGATGG ACCGCTTCTT GACACGTGGA
TATGTAAAGG GCTCTAGGAA CCTGCAGTTG CTGGGAATCG CCTGCACCAC CTTGGCAACC CGCATTGAAG AGAATCAACC
CTATAATTGG TAATGGCTCC CTTAAATGAC CAGTTTCAGT ATGAATACTT CTGCAAGTTG TTGGTGTCTG CTTGTCTGGT
ACTCACCTAA ATAGTTCGTC TCATTTGAAT ATAGCATGTA TTATTAAATG GGATAGTGCT CAATTGCAAT GCTGCAAATT
CCTTAGTATT CTTTGATAGT TTGATTTTTC TGAAAGTTGA ACTTAATTCT AACAGACATT AGCATGAGTT TATGAGTTTA
ATTATGTTCT ATAAATAACT TAATAACAAC AGGAACATCC GATGGTAACT CATATCTCAT CTAGTAGCTA TTTATCACTT
TCAATACTGA GCACTGCATG TGAGAACTCA GACCATTGGA CCATTGTTCT ACAAAAAGGT TTCACACGAT GGGTATTTTA
GAAATGAAgg gcttgtttgg ttctaagcca ttgtgggcca taccaatttt ttggcaatgg caagatttag ccactccaaa
atcttggcaa aggacttgtt tggtttgttg acaaaCTTTT TGGCAAGATT GATTAGTTTA GTATTTAGTT TGCTACCAAG
GAAAAATATT GGTGTTGCCA AAATTTGGTG ACAAAAAGAA AGCTAACAAA ATTTTAGGCA GACCAAAATA TTGGTATGGT
TTTGATTGGC TGAGAACCAA ACACACCAGA AGTTTCTTGA TTGTGTTGAC TATGATCAAG CATCTCTCAA AATAATTTAC
CGCGCCAGTT GGCATCCTTG AGCTATTGTT TTTTAAGAAA AAAAGAACTA AGCTATCAAT TATTGGGAGA GATGCGATTT
TGAGAAATTA TCACTTGCAT AGATCTCCTT GATATAGTTT TATTTCTCTG TTTTTGATGT TACAATAAAG CTATTACATC
AGCGCTCTGG TGGGCGAGAT ATTCTCTGTG TTTTCCCTTA AGTTTTAAAG ACTAAACTCA TATGAATCTT CAACATTTTT
GAAAGTAGAC CTTATTTGTA TCCCTGAGAA CTTGCTAGTA AATGAATGTT TTATGTGCCA CTTATTACTG CACAGAAGCA
TGTGAAGTGA ACCCAGGAAC TATTCTTCTT TGCCTGTCTA CTTTGCACGA AGTATCACTT TTGAACTTAT GAGTTTGCCT
CTGGATGCGC ATTTGTTTCA AGCGCCTAGT TTCTGTCAAG GGCAATGTGC AATATAGACC TTTTCTTTAG AACACTCTAC
AGGAACCTAA TAATACGATC TCTTTCAGCA TCCTTCAAAA AGCTTTCAAA GTAGGGATCA ATACTTACAG CCGAAGTGAG
GTCGTCGCCA TGGAGTGGCT GGTTCAGGAG GTCCTTGACT TCCAGTGCTT TGTCACAACA ACCCATCATT TCCTCTGGTA
CTATGCCTGT GTGTTTGCTT CATTTTCTGT GTCAGCTGGA CAGAATGAAT AAGAAACTTA CAATTGTTTG GTTCAACTTT
GCAGGTTCTA TCTGAAGGCT GCGAATGCAG ATGACAGAGT CGAGGACCTG GCGAAGTACT TGGCCTTGCT CTCACTTCTG
GACCACAAAC ATCTCTCCTT CTGGCCCTCC ACTGTGGCAG CCGCAGTGGT AGCCCTTGCT TGCCTTGCCA CAAACAATGA
GTCATCATGC CATTTGGTTA TGGAGGTAAA TACTTTAATC TTCCATCACT GGCTATGCTA TTTCTCTTAT ATCTGCAGTC
TGCTATTCGT TCAGAACTTC CTTAAGGAAA AAGATTCTGA ACTTTTGCTC AGTTTTGTAT GTTGCTGCTT TCATTTTATC
TCGTAGCCAG ATGACAAATG CCATGAATCA CCTAGGTCTT CACATGCTTA TTCCAATTCA CAACATACTG ATCCTTGCAA
AGAATACAAA TGTCTAACCA CTTGCTCTTC ACATAAATGC AGACTCACAT GAGAACGAAG AATGATGATC TGCCTGAATG
CCTAATGGTT TGTTTTCTCC TCAAATTATG ATTCTGGTGA AAAGTGTTGT ACACAGTTTG CAGCAATTTG ACTATTACCC
GGATCTTTAG CGTGCCATGG CATATAACGT GCAGTAATCC TTTTATGCAG AGTCTCGAAT GGTTGACCAA TTATGCTTCC
TGATTTGAAC AAACCCAGGT GATATGCCGA CCCAATCTTC TGCCCATTCC CAGAAACACA GTGTAGTACG TACAGAGTCG
CTTAGGAGGA GGTGTATATA GTACACGTGC ACTGTAGCTA ATTCTTCGTG CATAGCATTA GTTTGACAGC AGGGTAGAAA
AGAGGGCAAA GAAGCCGGCT AAACGTGGTT GTGATGGCAC CAGACTTATA GGGAGCATCG CAACCACGAA ATTTTGCTAC
TACTGCCGGC TTCAGTGACT ACGACTAACC TCCTGTTGTA AGCTGTCTTA AAATCAGCCT TCGTTGTGTT AAGGGCAACC
AAAGGTTGAG ACTTTGTTGT TCTAATCAAA CATCCTGTTT ACAAATTGCA ACTGGTGCCA GAATGAAATT TGTTCTCCGG
GTGGTATTGC ACTGCACGAG GTTCGATTCT GTGACCCTGA AAGACGCATA CTCAGATACT CTGATGCTCA GGTTTCAGAT
TCTGGGATGA ATAAAATGCT ACTAGTAGTA TCATCTTCTT CTGGATCTGC AAACAGATGT TCAGTTAGCT GAAGATCCAG
AGTACCACCT CGTTTGCTCA GGTACATGTC ATCAAAACAT CTACTACTAA TCTCTAGTTT TATTCTCTAG ACTTCTCTAT
TCCAATCTAT CTCCAGGATG CAACAGGAAG GGTCTGCATC CAGGTGGGCT ACCTGAAGTG GACGAAGCGG TCATCTTCGT
GCCGCTGCTC GAGTGGCCTA GTGGGGACCC CGGCTGCGCC CGATGCCTCG GCCACTTTAA AAACTCGGAT CGCGAGAGTT
CCTGCACGCC ATAAAAATGA GGAAAACGAG GTGGGGAGGG CGTGGCTTCT TTTCTCTATG ATGAAGTGCG TGGCATTTGT
TGAGCCATCC TAATCAGAGT GTTGTTCATG CATGTGCCCC GAATGTTGGG GGCGTCTGCA GAAAGAAGGG AGGGCGTTCG
CGTACACCCC CCTTTCAGCC CCACTTGCGC CCGCGCTCTC GTTGAGCCGT CTGCCTTTTG GGGTTCTAGA GTGAATAGGG
TCGGCACGTT AGCGGCGAGC CGGCGACGGG TAATGTGGTG TGCCAACAAC TTTCAGCTGC TGCTGAAGTG AAGAGCAGGT
GGCGATCAAC CAGTCCCGGC ACTGAACTAC TGAACCTGAA GTGGTTACTC CATTCATCGA CAGAGATATT TAATTATTTG
TCACTTTTAG ATGTAATATT TTACCACATA AACCTACAAA TCATAAACAT ATAAGTGACA AATTATTTAA CGCCACATCG
AAAAATGGTA AATGCTTATT TGCCCCTTCC CACTCTC

Locus: Os03g0225200

Loading...

Locus: Os03g0225200

Loading...