Os03t0225200-02

Locus

Os03g0225200

Description

Similar to cyclin, N-terminal domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SDS

CGSNL Gene Name

SOLO DANCERS

Oryzabase Gene Symbol Synonym(s)

OsSDS, Orysa;SDS

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK065907 (DDBJ, Best hit)

Protein Evidence

B7EN10 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of cyclin-dependent protein kinase activity (GO:0000079)

Biological Process: regulation of cell cycle (GO:0051726)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein kinase binding (GO:0019901)

Functional domain (InterPro)

Cyclin, C-terminal (IPR004367)

Cyclin, N-terminal (IPR006671)

Cyclin-like (IPR013763)

Cyclin A/B/D/E (IPR014400)

Full-length cDNA

J013044F04 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0225200-02)

RiceXPro (AK065907)

Others

Oryzabase (9119)

KEGG (Os03t0225200-02)

Transcript

1667 bp

>Os03t0225200-02 Similar to cyclin, N-terminal domain containing protein.
AGGCCCGTAGCATCACAAATTCACAATTCACACACAAAGCACACAGCGCCGCACGCCAAT
GCCTCCTACCATGCTTGCATCGGTGCCGACGAGGCCGCGCTCCCATCCCTTCCGCCGGCG
GCGAGGCGCGGCGGCGGCGGCTCCTCCTCTGCTCCCTGATCAGATCGCGGCGGCGGCGGC
GGCGGCAGCCAAGCGACCCGCGGAGTCGTccacctcggcctcctcctgcttccacagcga
ggtcatctccgccacctccaccacctgccccGAGCAGCTCGCCAACGACGCCGAGACGAC
CGCCTACTCCTCAGCCCGCGAGGACCTCACGCTGTCGGAGACCGAGGAGGAGGAGGAGGA
GGAGGAGGTGCGCAGTGGTCCCTGCATCTGCACCGATTGCTCGTTTAGCCCCCTTCATGA
GTCGTCCTCGTCGTCCGACGACGACAACGCCGTGCCCTCCCCCACCTTCTCCCTGTTCCT
CGCCTTGGCGGAGCAGTTCGTCCCCTTCACGCATCCCAAAACGCCCACCGCCACGGATGT
CGCTCTACAAGCGGGAGAGGGGAAGAGATTTGAGGACTTGGACAATGAGGTGAGCTACGA
GCGGTTCCGGCGGCGCGAGCGGCGAGGGGTGGTAGCCCGCGACTACATTGAGGTGTACTC
CTCCATGCTCGGCAGCTACGGCCGCGCCGTCGTGGAGCAGCGCGTTGTCATGGTGAACTG
GATCATGGAGCATTCACAAGCGATGAAGCTGCAGCCAGAGACCGTGTTCATGGGGATAGG
GCTGATGGACCGCTTCTTGACACGTGGATATGTAAAGGGCTCTAGGAACCTGCAGTTGCT
GGGAATCGCCTGCACCACCTTGGCAACCCGCATTGAAGAGAATCAACCCTATAATTGCAT
CCTTCAAAAAGCTTTCAAAGTAGGGATCAATACTTACAGCCGAAGTGAGGTCGTCGCCAT
GGAGTGGCTGGTTCAGGAGGTCCTTGACTTCCAGTGCTTTGTCACAACAACCCATCATTT
CCTCTGGTTCTATCTGAAGGCTGCGAATGCAGATGACAGAGTCGAGGACCTGGCGAAGTA
CTTGGCCTTGCTCTCACTTCTGGACCACAAACATCTCTCCTTCTGGCCCTCCACTGTGGC
AGCCGCAGTGGTAGCCCTTGCTTGCCTTGCCACAAACAATGAGTCATCATGCCATTTGGT
TATGGAGACTCACATGAGAACGAAGAATGATGATCTGCCTGAATGCCTAATGAGTCTCGA
ATGGTTGACCAATTATGCTTCCTGATTTGAACAAACCCAGGTGATATGCCGACCCAATCT
TCTGCCCATTCCCAGAAACACAGTGTAGTACGTACAGAGTCGCTTAGGAGGAGGTGTATA
TAGTACACGTGCACTGTAGCTAATTCTTCGTGCATAGCATTAGTTTGACAGCAGGGTAGA
AAAGAGGGCAAAGAAGCCGGCTAAACGTGGTTGTGATGGCACCAGACTTATAGGGAGCAT
CGCAACCACGAAATTTTGCTACTACTGCCGGCTTCAGTGACTACGACTAACCTCCTGTTG
TAAGCTGTCTTAAAATCAGCCTTCGTTGTGTTAAGGGCAACCAAAGGTTGAGACTTTGTT
GTTCTAATCAAACATCCTGTTTACAAATTGCAACTGGTGCCAGAATG

CDS

1227 bp

>Os03t0225200-02 Similar to cyclin, N-terminal domain containing protein.
ATGCCTCCTACCATGCTTGCATCGGTGCCGACGAGGCCGCGCTCCCATCCCTTCCGCCGG
CGGCGAGGCGCGGCGGCGGCGGCTCCTCCTCTGCTCCCTGATCAGATCGCGGCGGCGGCG
GCGGCGGCAGCCAAGCGACCCGCGGAGTCGTccacctcggcctcctcctgcttccacagc
gaggtcatctccgccacctccaccacctgccccGAGCAGCTCGCCAACGACGCCGAGACG
ACCGCCTACTCCTCAGCCCGCGAGGACCTCACGCTGTCGGAGACCGAGGAGGAGGAGGAG
GAGGAGGAGGTGCGCAGTGGTCCCTGCATCTGCACCGATTGCTCGTTTAGCCCCCTTCAT
GAGTCGTCCTCGTCGTCCGACGACGACAACGCCGTGCCCTCCCCCACCTTCTCCCTGTTC
CTCGCCTTGGCGGAGCAGTTCGTCCCCTTCACGCATCCCAAAACGCCCACCGCCACGGAT
GTCGCTCTACAAGCGGGAGAGGGGAAGAGATTTGAGGACTTGGACAATGAGGTGAGCTAC
GAGCGGTTCCGGCGGCGCGAGCGGCGAGGGGTGGTAGCCCGCGACTACATTGAGGTGTAC
TCCTCCATGCTCGGCAGCTACGGCCGCGCCGTCGTGGAGCAGCGCGTTGTCATGGTGAAC
TGGATCATGGAGCATTCACAAGCGATGAAGCTGCAGCCAGAGACCGTGTTCATGGGGATA
GGGCTGATGGACCGCTTCTTGACACGTGGATATGTAAAGGGCTCTAGGAACCTGCAGTTG
CTGGGAATCGCCTGCACCACCTTGGCAACCCGCATTGAAGAGAATCAACCCTATAATTGC
ATCCTTCAAAAAGCTTTCAAAGTAGGGATCAATACTTACAGCCGAAGTGAGGTCGTCGCC
ATGGAGTGGCTGGTTCAGGAGGTCCTTGACTTCCAGTGCTTTGTCACAACAACCCATCAT
TTCCTCTGGTTCTATCTGAAGGCTGCGAATGCAGATGACAGAGTCGAGGACCTGGCGAAG
TACTTGGCCTTGCTCTCACTTCTGGACCACAAACATCTCTCCTTCTGGCCCTCCACTGTG
GCAGCCGCAGTGGTAGCCCTTGCTTGCCTTGCCACAAACAATGAGTCATCATGCCATTTG
GTTATGGAGACTCACATGAGAACGAAGAATGATGATCTGCCTGAATGCCTAATGAGTCTC
GAATGGTTGACCAATTATGCTTCCTGA

Protein

409 aa

>Os03t0225200-02 Similar to cyclin, N-terminal domain containing protein.
MPPTMLASVPTRPRSHPFRRRRGAAAAAPPLLPDQIAAAAAAAAKRPAESSTSASSCFHS
EVISATSTTCPEQLANDAETTAYSSAREDLTLSETEEEEEEEEVRSGPCICTDCSFSPLH
ESSSSSDDDNAVPSPTFSLFLALAEQFVPFTHPKTPTATDVALQAGEGKRFEDLDNEVSY
ERFRRRERRGVVARDYIEVYSSMLGSYGRAVVEQRVVMVNWIMEHSQAMKLQPETVFMGI
GLMDRFLTRGYVKGSRNLQLLGIACTTLATRIEENQPYNCILQKAFKVGINTYSRSEVVA
MEWLVQEVLDFQCFVTTTHHFLWFYLKAANADDRVEDLAKYLALLSLLDHKHLSFWPSTV
AAAVVALACLATNNESSCHLVMETHMRTKNDDLPECLMSLEWLTNYAS*

5'UTR

chr03:6561966..6562023 (- strand) : 58 bp

CDS

chr03:6561753..6561965 (- strand) : 213 bp

chr03:6561282..6561569 (- strand) : 288 bp

chr03:6561007..6561177 (- strand) : 171 bp

chr03:6559777..6559943 (- strand) : 167 bp

chr03:6558429..6558557 (- strand) : 129 bp

chr03:6558161..6558341 (- strand) : 181 bp

chr03:6557859..6557903 (- strand) : 45 bp

chr03:6557703..6557735 (- strand) : 33 bp

3'UTR

chr03:6557321..6557702 (- strand) : 382 bp

FASTA

>Os03t0225200-02 class=Sequence position=chr03:6557321..6562023 (- strand)
AGGCCCGTAG CATCACAAAT TCACAATTCA CACACAAAGC ACACAGCGCC GCACGCCAAT GCCTCCTACC ATGCTTGCAT
CGGTGCCGAC GAGGCCGCGC TCCCATCCCT TCCGCCGGCG GCGAGGCGCG GCGGCGGCGG CTCCTCCTCT GCTCCCTGAT
CAGATCGCGG CGGCGGCGGC GGCGGCAGCC AAGCGACCCG CGGAGTCGTc cacctcggcc tcctcctgct tccacagcga
ggtcatctcc gccacctcca ccacctgccc cacctccctc gccgcagctc AGCGCCCGGA GAAGCGGCCT CGGTACCAGG
ATGTGGACGA GGAGCAGCCC GCCGCCTCCG AGTGCTCCGA GATCATCGGT GGCGCGAGGC CGCGCGCCGC CGAGGTCGAG
GTCTCCGAGT CGTCGTGCCT CGCCTCCGTC CTCGAGTCCT ACCTCGCCTG CCCCGAGCAG CTCGCCAACG ACGCCGAGAC
GACCGCCTAC TCCTCAGCCC GCGAGGACCT CACGCTGTCG GAGACCGAGG AGGAGGAGGA GGAGGAGGAG GTGCGCAGTG
GTCCCTGCAT CTGCACCGAT TGCTCGTTTA GCCCCCTTCA TGAGTCGTCC TCGTCGTCCG ACGACGACAA CGCCGTGCCC
TCCCCCACCT TCTCCCTGTT CCTCGCCTTG GCGGAGCAGT TCGTCCCCTT CACGCATCCC AAAACGCCCA CCGCCACGGA
TGTCGCTCTA CAAGCGGGAG AGGTAAGCAG GTTCCACACA GCTTCTCTCA AATTTGTTGG AGTTTGGCTG CTCTCTCCCG
AATCAGTGCG ACATTTGATG TAATCAGATG GGAATTATTG TATCAGGGGA AGAGATTTGA GGACTTGGAC AATGAGGTGA
GCTACGAGCG GTTCCGGCGG CGCGAGCGGC GAGGGGTGGT AGCCCGCGAC TACATTGAGG TGTACTCCTC CATGCTCGGC
AGCTACGGCC GCGCCGTCGT GGAGCAGCGC GTTGTCATGG TGAACTGGAT CATGGAGGTC AGTATGCTCT GCATTGTACA
CGTATGCTGC GACCATGACT TTGCCTTGGT CCAATAATTC ATCTAGCTCG AGCGCAATTT GTTGTGTGGT AGCTGCAGAT
GTTTGTTGCA CGGGTATTGT GCTGATAATG CACATGTATA CTTTCGGAGT GCTGTACTGA TCTAGATTCT ATCAGCTTAT
CTGTCTGACT GATGTGTTCT GCAAGAACAG TAGTTGCTTG CATTTTGCAC TAACATGCTA CTCTGCAGTG TAAATGCTGT
GCTGGGTGGG AGTGCTGAGG TAGCAGATCC GGTTGTGATC TTGCATATTT TGTGTAGGGG AAGCTATCTG ATACCAATAT
ACGCATTGCA TTTGCTGATT CGTTTATCAC ACAGTTAGCT GCCTGTACAT TTTGCAGCAT TCCCCGTGTT AGTCTGCCAG
CAGTGTGGTG GTAATCCTAG TGATTTCAAT GTAACTCTAG TCATTAACTT TTATGTCATC GCATTCAAGT TCTATAGAGC
AGTGATAAAG ATTTTCTAGG TGCTTATTTT GGCATGCTTG CATATTTTTT TTGGATGTAA TGGCATGCTT GTATGAAAAG
AAAAGAGATA CATAGGATTT TTCTAGGTGT TTATTTTCGC ACCTGAAAGT TGCTCTGTAG TCATTTGCCA TCTGAAATCC
CATGGCATTG GGCATTGGCA TATGGCCTCC AGAAATGTCT GCATCACTTT TTACTTCTAA ACCTATATAT GCAATAAGTG
TTAGAAAAAC ATATTGCCAG TGTATTCCCT TTTTTTGTGT ATCCACCATC ATCTGAATTT AATCTTTTCT AACTCTAGTT
CCATCAGTTT ATATTTGCAT TGAAACTTCA GGTAGCCTTT GAAAATGAAA TCGCTGTGTG TTTTTTGTTT GAAGTTTTTT
TGGGCAACTC AGCGATAAGT ACTTAAGTGA TATGATCATT TATACTTGTA ATTTGATTTT TCTGAAAATA ATGTACTGTC
ATTTGTGGAG AATATGTTTG TTCTTACATA GAGTTCATAC ATAACTTGCA AAGAATGACT TGTTCTCTAT GCATCGCTAG
CATTCACAAG CGATGAAGCT GCAGCCAGAG ACCGTGTTCA TGGGGATAGG GCTGATGGAC CGCTTCTTGA CACGTGGATA
TGTAAAGGGC TCTAGGAACC TGCAGTTGCT GGGAATCGCC TGCACCACCT TGGCAACCCG CATTGAAGAG AATCAACCCT
ATAATTGGTA ATGGCTCCCT TAAATGACCA GTTTCAGTAT GAATACTTCT GCAAGTTGTT GGTGTCTGCT TGTCTGGTAC
TCACCTAAAT AGTTCGTCTC ATTTGAATAT AGCATGTATT ATTAAATGGG ATAGTGCTCA ATTGCAATGC TGCAAATTCC
TTAGTATTCT TTGATAGTTT GATTTTTCTG AAAGTTGAAC TTAATTCTAA CAGACATTAG CATGAGTTTA TGAGTTTAAT
TATGTTCTAT AAATAACTTA ATAACAACAG GAACATCCGA TGGTAACTCA TATCTCATCT AGTAGCTATT TATCACTTTC
AATACTGAGC ACTGCATGTG AGAACTCAGA CCATTGGACC ATTGTTCTAC AAAAAGGTTT CACACGATGG GTATTTTAGA
AATGAAgggc ttgtttggtt ctaagccatt gtgggccata ccaatttttt ggcaatggca agatttagcc actccaaaat
cttggcaaag gacttgtttg gtttgttgac aaaCTTTTTG GCAAGATTGA TTAGTTTAGT ATTTAGTTTG CTACCAAGGA
AAAATATTGG TGTTGCCAAA ATTTGGTGAC AAAAAGAAAG CTAACAAAAT TTTAGGCAGA CCAAAATATT GGTATGGTTT
TGATTGGCTG AGAACCAAAC ACACCAGAAG TTTCTTGATT GTGTTGACTA TGATCAAGCA TCTCTCAAAA TAATTTACCG
CGCCAGTTGG CATCCTTGAG CTATTGTTTT TTAAGAAAAA AAGAACTAAG CTATCAATTA TTGGGAGAGA TGCGATTTTG
AGAAATTATC ACTTGCATAG ATCTCCTTGA TATAGTTTTA TTTCTCTGTT TTTGATGTTA CAATAAAGCT ATTACATCAG
CGCTCTGGTG GGCGAGATAT TCTCTGTGTT TTCCCTTAAG TTTTAAAGAC TAAACTCATA TGAATCTTCA ACATTTTTGA
AAGTAGACCT TATTTGTATC CCTGAGAACT TGCTAGTAAA TGAATGTTTT ATGTGCCACT TATTACTGCA CAGAAGCATG
TGAAGTGAAC CCAGGAACTA TTCTTCTTTG CCTGTCTACT TTGCACGAAG TATCACTTTT GAACTTATGA GTTTGCCTCT
GGATGCGCAT TTGTTTCAAG CGCCTAGTTT CTGTCAAGGG CAATGTGCAA TATAGACCTT TTCTTTAGAA CACTCTACAG
GAACCTAATA ATACGATCTC TTTCAGCATC CTTCAAAAAG CTTTCAAAGT AGGGATCAAT ACTTACAGCC GAAGTGAGGT
CGTCGCCATG GAGTGGCTGG TTCAGGAGGT CCTTGACTTC CAGTGCTTTG TCACAACAAC CCATCATTTC CTCTGGTACT
ATGCCTGTGT GTTTGCTTCA TTTTCTGTGT CAGCTGGACA GAATGAATAA GAAACTTACA ATTGTTTGGT TCAACTTTGC
AGGTTCTATC TGAAGGCTGC GAATGCAGAT GACAGAGTCG AGGACCTGGC GAAGTACTTG GCCTTGCTCT CACTTCTGGA
CCACAAACAT CTCTCCTTCT GGCCCTCCAC TGTGGCAGCC GCAGTGGTAG CCCTTGCTTG CCTTGCCACA AACAATGAGT
CATCATGCCA TTTGGTTATG GAGGTAAATA CTTTAATCTT CCATCACTGG CTATGCTATT TCTCTTATAT CTGCAGTCTG
CTATTCGTTC AGAACTTCCT TAAGGAAAAA GATTCTGAAC TTTTGCTCAG TTTTGTATGT TGCTGCTTTC ATTTTATCTC
GTAGCCAGAT GACAAATGCC ATGAATCACC TAGGTCTTCA CATGCTTATT CCAATTCACA ACATACTGAT CCTTGCAAAG
AATACAAATG TCTAACCACT TGCTCTTCAC ATAAATGCAG ACTCACATGA GAACGAAGAA TGATGATCTG CCTGAATGCC
TAATGGTTTG TTTTCTCCTC AAATTATGAT TCTGGTGAAA AGTGTTGTAC ACAGTTTGCA GCAATTTGAC TATTACCCGG
ATCTTTAGCG TGCCATGGCA TATAACGTGC AGTAATCCTT TTATGCAGAG TCTCGAATGG TTGACCAATT ATGCTTCCTG
ATTTGAACAA ACCCAGGTGA TATGCCGACC CAATCTTCTG CCCATTCCCA GAAACACAGT GTAGTACGTA CAGAGTCGCT
TAGGAGGAGG TGTATATAGT ACACGTGCAC TGTAGCTAAT TCTTCGTGCA TAGCATTAGT TTGACAGCAG GGTAGAAAAG
AGGGCAAAGA AGCCGGCTAA ACGTGGTTGT GATGGCACCA GACTTATAGG GAGCATCGCA ACCACGAAAT TTTGCTACTA
CTGCCGGCTT CAGTGACTAC GACTAACCTC CTGTTGTAAG CTGTCTTAAA ATCAGCCTTC GTTGTGTTAA GGGCAACCAA
AGGTTGAGAC TTTGTTGTTC TAATCAAACA TCCTGTTTAC AAATTGCAAC TGGTGCCAGA ATG

Locus: Os03g0225200

Loading...

Locus: Os03g0225200

Loading...