Os03t0227700-01

Locus

Os03g0227700

Description

Cytochrome P450 90B2, Brassinosteroid C-22 hydroxylase, Brassinosteroids biosynthesis

RAP-DB Gene Symbol Synonym(s)

OsDWF4, OsDWARF4, CYP90B2

RAP-DB Gene Name Synonym(s)

DWARF4

CGSNL Gene Symbol

DWARF4

CGSNL Gene Name

DWARF4

Oryzabase Gene Symbol Synonym(s)

OsDWARF4, osdwarf4, OsDWF4, DWF4, CYP90B2, OsCYP90B2, D4, OsD4

Oryzabase Gene Name Synonym(s)

brassinosteroid C-22 hydroxylase, Cytochrome P450 90B2

Transcript Evidence

AK243298

AB206579

Protein Evidence

Q5CCK3

Literature

PMID: 29613784

PMID: 16369540

Note

Manual Curation

April 20, 2018

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (GO:0016705)

Molecular Function: heme binding (GO:0020037)

Functional domain (InterPro)

Cytochrome P450 superfamily (IPR036396)

Cytochrome P450 (IPR001128)

Cytochrome P450, E-class, group I (IPR002401)

Full-length cDNA

J100053J04 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0227700-01)

Others

Oryzabase (9061)

KEGG (Os03t0227700-01 (EC:1.14.13.-))

Transcript

1930 bp

>Os03t0227700-01 Cytochrome P450 90B2, Brassinosteroid C-22 hydroxylase, Brassinosteroids biosynthesis
GAGGTGAAGTGGGCACACCTTCCTCTCCTAGCTACCAAATTCTCTTCTTTGCGCAAAGCA
GCCAGCAGAAAGGTTTTTGCAGACTCAGAGGCGTGGAGGATACTCTTGTAATTTGGCGAG
CAAGAGGGAAAAATAAATAAATTTTGTAGTAGAAGAAGAGAGAGCAACTGGCCGGCAGTC
GGCGGGCATCTCGATCGGTGTATAGCTAGCTTGCTTGCAGGCTGATGGCCGCCATGATGG
CGTCCATAACCAGCGAGCTGCTCTTCTTTCTCCCCTTCATCCTCCTTGCCCTGCTCACGT
TCTACACCACCACCGTGGCCAAATGCCACGGCGGGCACTGGTGGCGAGGTGGGACGACGC
CGGCGAAGAGGAAGCGGATGAACCTGCCGCCCGGCGCCGCCGGGTGGCCGCTCGTCGGCG
AGACGTTCGGCTACCTCCGCGCCCACCCCGCCACCTCCGTCGGCCGCTTCATGGAGCAGC
ACATCGCACGGTACGGGAAGATATACCGGTCGAGCCTGTTCGGGGAGCGGACGGTGGTGT
CGGCGGACGCGGGGCTCAACCGGTACATCCTGCAGAACGAGGGGAGGCTGTTCGAGTGCA
GCTACCCGCGCAGCATCGGCGGCATCCTGGGCAAGTGGTCCATGCTGGTCCTCGTCGGGG
ACCCGCACCGCGAGATGCGCGCCATCTCCCTCAACTTCCTCTCCTCCGTCCGCCTCCGCG
CCGTCCTCCTCCCCGAGGTCGAGCGCCACACCCTCCTCGTCCTCCGCGCCTGGCCCCCTT
CCTCCACCTTCTCCGCTCAGCACCAAGCCAAGAAGttcacgttcaacctgatggcgaaga
acataatgagcatggacccgggggaggaagagacggagcggctgcggcgggagtacatca
ccttcatgaagggcgtggtctccgcgccgctcaacctgcccgggacgccctactggaagg
ctctcaagTCGCGTGCTGCCATTCTCGGAGTAATAGAGAGGAAAATGGAAGAGCGGGTTG
AGAAGCTGAGCAAGGAGGATGCAAGCGTAGAGCAAGACGATCTTCTCGGATGGGCTCTGA
AACAATCTAACCTTTCAAAAGAGCAAATCCTGGACCTCTTGCTGAGCTTGCTCTTCGCCG
GGCACGAGACGTCGTCCATGGCGCTCGCCCTCGCCATCTTCTTCCTTGAAGGCTGCCCCA
AGGCTGTCCAAGAACTGAGGGAGGAGCATCTTGGGATTGCAAGGAGACAAAGGCTAAGAG
GGGAGTGCAAATTGAGCTGGGAAGACTACAAAGAGATGGTTTTCACGCAATGTGTCATAA
ACGAGACGTTGCGGCTAGGAAACGTGGTCAGGTTCCTGCACCGGAAGGTCATCAAGGACG
TGCACTACAAGGGTTATGACATTCCAAGCGGATGGAAGATCCTGCCGGTGTTAGCCGCGG
TGCATCTGGACTCGTCCCTGTACGAGGACCCCCAGCGCTTCAATCCCTGGAGATGGAAGA
GTAGCGGATCATCCGGCGGCTTGGctcagagcagcagcttcatgccgtacggcggcggga
cgcggctgtgcgccgggtcggagctcgcgaagctggagatggccgtgttcttgcaccacc
tggtGCTCAACTTCAGGTGGGAGCTCGCCGAGCCGGACCAAGCCTTCGTCTTCCCCTTCG
TCGACTTCCCCAAGGGCCTTCCCATTAGGGTTCATAGAATTGCACAGGATGATGAGCAGG
AGTAAAAAAAAGGAAAGAAAAAAAAGAAGAGCCTTTTGACCTAATTGTTGGATATATAAA
ATCAAAAGGAAATATCTAGGAAAGTACAGGATGCATGTACACGTTTTCGTTTTCGTTTTC
CTTTTTTTTGGTGGCAGTTTGTGCTATGTGTAGATGTGATCAGGAAAGGatatagtaaga
tagtagtaat

CDS

1521 bp

>Os03t0227700-01 Cytochrome P450 90B2, Brassinosteroid C-22 hydroxylase, Brassinosteroids biosynthesis
ATGGCCGCCATGATGGCGTCCATAACCAGCGAGCTGCTCTTCTTTCTCCCCTTCATCCTC
CTTGCCCTGCTCACGTTCTACACCACCACCGTGGCCAAATGCCACGGCGGGCACTGGTGG
CGAGGTGGGACGACGCCGGCGAAGAGGAAGCGGATGAACCTGCCGCCCGGCGCCGCCGGG
TGGCCGCTCGTCGGCGAGACGTTCGGCTACCTCCGCGCCCACCCCGCCACCTCCGTCGGC
CGCTTCATGGAGCAGCACATCGCACGGTACGGGAAGATATACCGGTCGAGCCTGTTCGGG
GAGCGGACGGTGGTGTCGGCGGACGCGGGGCTCAACCGGTACATCCTGCAGAACGAGGGG
AGGCTGTTCGAGTGCAGCTACCCGCGCAGCATCGGCGGCATCCTGGGCAAGTGGTCCATG
CTGGTCCTCGTCGGGGACCCGCACCGCGAGATGCGCGCCATCTCCCTCAACTTCCTCTCC
TCCGTCCGCCTCCGCGCCGTCCTCCTCCCCGAGGTCGAGCGCCACACCCTCCTCGTCCTC
CGCGCCTGGCCCCCTTCCTCCACCTTCTCCGCTCAGCACCAAGCCAAGAAGttcacgttc
aacctgatggcgaagaacataatgagcatggacccgggggaggaagagacggagcggctg
cggcgggagtacatcaccttcatgaagggcgtggtctccgcgccgctcaacctgcccggg
acgccctactggaaggctctcaagTCGCGTGCTGCCATTCTCGGAGTAATAGAGAGGAAA
ATGGAAGAGCGGGTTGAGAAGCTGAGCAAGGAGGATGCAAGCGTAGAGCAAGACGATCTT
CTCGGATGGGCTCTGAAACAATCTAACCTTTCAAAAGAGCAAATCCTGGACCTCTTGCTG
AGCTTGCTCTTCGCCGGGCACGAGACGTCGTCCATGGCGCTCGCCCTCGCCATCTTCTTC
CTTGAAGGCTGCCCCAAGGCTGTCCAAGAACTGAGGGAGGAGCATCTTGGGATTGCAAGG
AGACAAAGGCTAAGAGGGGAGTGCAAATTGAGCTGGGAAGACTACAAAGAGATGGTTTTC
ACGCAATGTGTCATAAACGAGACGTTGCGGCTAGGAAACGTGGTCAGGTTCCTGCACCGG
AAGGTCATCAAGGACGTGCACTACAAGGGTTATGACATTCCAAGCGGATGGAAGATCCTG
CCGGTGTTAGCCGCGGTGCATCTGGACTCGTCCCTGTACGAGGACCCCCAGCGCTTCAAT
CCCTGGAGATGGAAGAGTAGCGGATCATCCGGCGGCTTGGctcagagcagcagcttcatg
ccgtacggcggcgggacgcggctgtgcgccgggtcggagctcgcgaagctggagatggcc
gtgttcttgcaccacctggtGCTCAACTTCAGGTGGGAGCTCGCCGAGCCGGACCAAGCC
TTCGTCTTCCCCTTCGTCGACTTCCCCAAGGGCCTTCCCATTAGGGTTCATAGAATTGCA
CAGGATGATGAGCAGGAGTAA

Protein

507 aa

>Os03t0227700-01 Cytochrome P450 90B2, Brassinosteroid C-22 hydroxylase, Brassinosteroids biosynthesis
MAAMMASITSELLFFLPFILLALLTFYTTTVAKCHGGHWWRGGTTPAKRKRMNLPPGAAG
WPLVGETFGYLRAHPATSVGRFMEQHIARYGKIYRSSLFGERTVVSADAGLNRYILQNEG
RLFECSYPRSIGGILGKWSMLVLVGDPHREMRAISLNFLSSVRLRAVLLPEVERHTLLVL
RAWPPSSTFSAQHQAKKFTFNLMAKNIMSMDPGEEETERLRREYITFMKGVVSAPLNLPG
TPYWKALKSRAAILGVIERKMEERVEKLSKEDASVEQDDLLGWALKQSNLSKEQILDLLL
SLLFAGHETSSMALALAIFFLEGCPKAVQELREEHLGIARRQRLRGECKLSWEDYKEMVF
TQCVINETLRLGNVVRFLHRKVIKDVHYKGYDIPSGWKILPVLAAVHLDSSLYEDPQRFN
PWRWKSSGSSGGLAQSSSFMPYGGGTRLCAGSELAKLEMAVFLHHLVLNFRWELAEPDQA
FVFPFVDFPKGLPIRVHRIAQDDEQE*

5'UTR

chr03:6737549..6737772 (+ strand) : 224 bp

CDS

chr03:6737773..6738038 (+ strand) : 266 bp

chr03:6738207..6738531 (+ strand) : 325 bp

chr03:6738635..6738787 (+ strand) : 153 bp

chr03:6741601..6741852 (+ strand) : 252 bp

chr03:6742001..6742093 (+ strand) : 93 bp

chr03:6742886..6742964 (+ strand) : 79 bp

chr03:6743062..6743168 (+ strand) : 107 bp

chr03:6744056..6744301 (+ strand) : 246 bp

3'UTR

chr03:6744302..6744486 (+ strand) : 185 bp

FASTA

>Os03t0227700-01 class=Sequence position=chr03:6737549..6744486 (+ strand)
GAGGTGAAGT GGGCACACCT TCCTCTCCTA GCTACCAAAT TCTCTTCTTT GCGCAAAGCA GCCAGCAGAA AGGTTTTTGC
AGACTCAGAG GCGTGGAGGA TACTCTTGTA ATTTGGCGAG CAAGAGGGAA AAATAAATAA ATTTTGTAGT AGAAGAAGAG
AGAGCAACTG GCCGGCAGTC GGCGGGCATC TCGATCGGTG TATAGCTAGC TTGCTTGCAG GCTGATGGCC GCCATGATGG
CGTCCATAAC CAGCGAGCTG CTCTTCTTTC TCCCCTTCAT CCTCCTTGCC CTGCTCACGT TCTACACCAC CACCGTGGCC
AAATGCCACG GCGGGCACTG GTGGCGAGGT GGGACGACGC CGGCGAAGAG GAAGCGGATG AACCTGCCGC CCGGCGCCGC
CGGGTGGCCG CTCGTCGGCG AGACGTTCGG CTACCTCCGC GCCCACCCCG CCACCTCCGT CGGCCGCTTC ATGGAGCAGC
ACATCGCACG GTCGGTGGTT TCATTACTCG GTACACGCAC ACAGCTATAT AAGCACGCGC ACTGCTCGCC TCGCCGTGAA
GCAAGCTTAG CTAGTAGCTA GGATATCGAT CGATCGGTAA TAATAGGCTG ACGGCGAGCT GGGGGGTGGC GTGCGGTTGC
GTGCGTGCGT GCATGCAGGT ACGGGAAGAT ATACCGGTCG AGCCTGTTCG GGGAGCGGAC GGTGGTGTCG GCGGACGCGG
GGCTCAACCG GTACATCCTG CAGAACGAGG GGAGGCTGTT CGAGTGCAGC TACCCGCGCA GCATCGGCGG CATCCTGGGC
AAGTGGTCCA TGCTGGTCCT CGTCGGGGAC CCGCACCGCG AGATGCGCGC CATCTCCCTC AACTTCCTCT CCTCCGTCCG
CCTCCGCGCC GTCCTCCTCC CCGAGGTCGA GCGCCACACC CTCCTCGTCC TCCGCGCCTG GCCCCCTTCC TCCACCTTCT
CCGCTCAGCA CCAAGCCAAG AAGGTACAAC ACACATCGTC CTCCATTAAG TTGAGCATGC ATATATCAAT CAGCTCGCTC
TAGCGATCAA TATCAATGAA ACGCGCGTTT GCGTGCGTgc gtgcagttca cgttcaacct gatggcgaag aacataatga
gcatggaccc gggggaggaa gagacggagc ggctgcggcg ggagtacatc accttcatga agggcgtggt ctccgcgccg
ctcaacctgc ccgggacgcc ctactggaag gctctcaagg TACGTACTCG TAGCTACTAG Ctactccctc cgtttcgaaa
tgtttgacgc cgttgacttt ttatcacata tttgaccgtt cgttttattt aaaaaaatta agtaattatt aattattttc
ctatcatttg attcattgtt aaatatattt ttatgtaggc atataatttt acatatctca caaaagtttt taaataagac
gaacggtcaa acatttgcta aaaagtcaac ggtgtcaaat atttcgaaac ggaggaagta GCTAGCTACC ACCCCACCCG
TGCGGATTGA TCGATCGATC GATGTCCCTC TCTGCCTACA CACACCCTGC GCCCCGGCCG TACGCGCGCA AAGTCGTGCG
CGCATGAGTT Ttactccttc cgtttcaaaa aaaaaacgac ctagacaagt aatatgatgt aacctagaac aacgaatcta
tacaggagta tatccaaatt cattgtccta gattacatca tatctttgtc tatgttgcct tttttaggag gagagagtaC
TTTACATATG AGTTATGACC GGCCGGCCAG GTTCCTTTCT TCCCCTATTC CGTATGCATA CTATAAGCAG CTGCATATAG
GCATATACTA CTATACCCAG CTTAGCTAAA GCAAACAACT TGCAACGACG ATCATGTGCA GGTCCCTGTT GACAGAGGTT
AGAGATGTAA ACCATTTTTG TTGTTTTCAT TATCTAAAGA GAAAACAAGT TACTACGACG ATCGAGATGT ACGCAAGGGG
ATCATATTTA TATTGGAGAG GAGAGAGAGA TGATTTGCGA CTTGTGAGTG ATAAGTGAAT ATATATACTA TATATTTGTG
TAGGAGTGAC GATGACTTCC CTGTCAATGT TTTGTTTGGT ATGCACACGG GGGGAAAAGA GTTTAGAGAA AGGAATTGGC
TAGAGAGGGC CAGGTTTAGT TTCTTTAATT TTTGTTTGGT GGTTTTGTGT GTAGCTAGTC CGCATGCATG ATATATCATA
TATATGCATG GCCCATCATT AGATATATAT ACATGACGGC AGTGCACTTA TTATATATAT GTAGGGGCAT ATACAAGGTG
TATGTGTTTA GAATTGTGGA TGGTCCAGGA ATTGTTGCAG CTAGTTCTAT ACTAGCATAG TGAATTAGTG ATCCATATCG
AGATCAGGTC CAATCGGTCA GCTCGCACAG CGGGTCTTTT AGTACGATTT GTTCGGACAA ATTATCTTGC CTTTGAGATA
ATCAACATAG GATTGAAACT GCATACTAGC AATAGACCAT AGCTATTTGG CAATATAGAA AGCTAAAAAA TGTTGATTGA
AAGGTGCGTG CATGCATGCT AGCAGTATGT CTTTTAGGCC AGGTCCAGTT TTTTTTTTTT TCTCAAAGGC AGTTGCTTAA
GGTGAAATTC TAGCAGAGGT CATATGAATA TATTTATTAT CTTCCAAACA TGAGCCAAAA CCTATATATA GTTAACTCAA
AAAACCATGC ATTGGTACTT CTTCTGAGTA TGCATCCTGG GGACTGATCG ATCATGCAGA TTCTTTTCTT TCTTTTTCCC
TGGGGACGTA CTGATCATCA CTCATGTGAG CATAAAATGT TGCCTACTTT TTACTGCATG TGAGGTCACA CTCAAATGAT
CTTTATTGAT TGCCTCAGCA TGCATGCTGC TAGCTTTCAC GATCTCTCTC CGATACACAC ACCCTGTGCT GTGCTCAACA
GCATGCAACC TGGCAGGTGG AATTTTTAAT CTGTTGGAAA GTAAATGACC AACCTTCATA ATTTGGCATG ATTATATGCT
GGGGAATCTA TCATTTATCA TGATTCAACC GCTGACCAAA CTCTTTGCCA CACACCCGAA CCACATTAAT TTCGTTAAGC
GGATGATTAG CCAGCAACCT TCACAGTTTG GTTTTAATTA GTTAATGAAA GGGTGCTTGT AGTTTTATTA GCTGAAGAGA
CACTGCAGTA CTCCTACTGA GCGTTCTCCT TAATTGGGAA ATAGATCTCT GCAGTACTAT CCTTTAACTT TAAGTGAATA
ACATGTAGCT AGGTCTCACA CTTATCAGGC CCACACATCA GTGATCCAAG TCAAATGGCA ATACACCATA GGAGATTCTT
CCACTAATTG GCTAACAAAA ATAAACTGTG ATCACTGATC ACAGCTGCTA ACACTATAAC ACATTAATTT GCATGTCTCA
TGAAATGCCA GATGAGTTGG ATTAATTATC TATCTTATGT TCAGTGCCGA GGAATATACA AGGAAACATC ATTGGTATAG
TTGTGGAGTT CTGAGTGCAT TATCTCACCC AGTACGGTCA AATTAATCCT AGTCTCCGTA AATATGGTTG TGTGCACTCT
TAGTTAATTA GTGTAGACCC GGAAATTATA CTTTGTCGAG AATGTTGTTA TCCGTGTGTT AAGTTTCAAG TACCCTGCAG
GCCTATAACT AAACACTGCC AACATGGATG TTTAAGAATG AATTATACAT ACAGCGCACT TGGAAAAGAA AAGGGGTAGC
TACCCAGCTG AAGAACACCT CTCTCTCATT TGAAGGTCGA CACAATATGT GTCTTTTCTA TATCGAAAGG AAACGACATT
TTTTCTCTTC AAAACAGAAA GCTATGACAA GAGACATAAT CCTAGACTAG TAGGCGGTTA GGCAACACCA TATCTGAATT
TGATAGGTGT CCCACATATT TTTTTTCTTT TCCTGATAAG AAGGAACTTT TCACCGTGAG CTTATTTTTT TCTGTTCTAT
GTCGACATTA GTTCCATGAT GTTTACTGTG TATTTTTACT GTTCCCCTGC AGTCGCGTGC TGCCATTCTC GGAGTAATAG
AGAGGAAAAT GGAAGAGCGG GTTGAGAAGC TGAGCAAGGA GGATGCAAGC GTAGAGCAAG ACGATCTTCT CGGATGGGCT
CTGAAACAAT CTAACCTTTC AAAAGAGCAA ATCCTGGACC TCTTGCTGAG CTTGCTCTTC GCCGGGCACG AGACGTCGTC
CATGGCGCTC GCCCTCGCCA TCTTCTTCCT TGAAGGCTGC CCCAAGGCTG TCCAAGAACT GAGGGTACAG AGAATTACAG
ATTCGAAATT AACATCTACT GTCACTAGCT CAGTGCTACG TTTAACTGTA GAGCAACAAT TGCAGAAAGC GAAGGCATCA
GAAATGACAT GGGAATCGAT TAGTTACACT CACACTGACG CGTGACATGC AGGAGGAGCA TCTTGGGATT GCAAGGAGAC
AAAGGCTAAG AGGGGAGTGC AAATTGAGCT GGGAAGACTA CAAAGAGATG GTTTTCACGC AATGTGTAAG GCCCCCCCTA
CTTTGTTCCT TCCGATCCCT CCTCCCTAAA CGCTACTAAT ATAAATCGGT GCAAAGGCTT TGTGCTAGCG TAGCTCTTGC
TGTTTTGTTT GGTCACTTGC GTAGAGAGAT AGCAACTTCC CGAAATGTCA TGTACGAATG GAGACTGAAA GCTCTGCGAA
ATAATTGCCG GGCCACGTAC TACAGTACTT ACGCTCCCTC TCTTCAGTTT GGATCGATCG AGCTAAGAAG GCGCACGCAT
GTGTGCATTG ATCGATAGAG TCGATCTGTT CTGCCTTGTA AGCTAGCCAG CTGAGGTTCT TTCGCCTTGG AAGTTTCTAC
AGGGTGAGGC CCATCGTCTT GCAACGATCC AAATGCCATG ACAAGTACCT GTTGTTGTAG GCTTCCAGTA GCACGGCCTG
CCCCCAAGAA GGTATCTGAA TCTTCTGCAT TGCTGTTCAG ACGGCAGAGC AGAACATGCC GAAATACCAT TCCAGTCAGT
TGCAGTATAT GTGTGTGGTG GTATCAGATA AAGGAGCAGA GTAATTTGAG GCCTTAGAAA TTCAGATGAG TTGCTCGACA
ATTGTCGCCT ACCGATCGAG AATAAGTTGC ATGCATGTAT GTGATGTAAT TATGGGTCTT AGTCAGCAGG ATAGTTTAGT
CGCTGCAGTA CTGTAGATTG TAGTACTTGC GTTCAAAGCA GACCCAAAAC AGAACTTGCA TTCAGGAAAC AAAACATGAA
AAAAGAAATA TACAGTACTT GGCACTGATA TTTCTTTTGT TTGGGTCCTT ATTGCAGGTC ATAAACGAGA CGTTGCGGCT
AGGAAACGTG GTCAGGTTCC TGCACCGGAA GGTCATCAAG GACGTGCACT ACAAGGGTGA GTAGCTCGAT TTCACTCTTC
TTCCCTGAAT CGACCTCTCC TCTATCTGAC AGCAGAAGCT AACTGAACTG AACTGAACTG AACTGAACTG AAGGTTATGA
CATTCCAAGC GGATGGAAGA TCCTGCCGGT GTTAGCCGCG GTGCATCTGG ACTCGTCCCT GTACGAGGAC CCCCAGCGCT
TCAATCCCTG GAGATGGAAG GTCAGTCGCA GTAGGATTAT CAGTGAATCT AATCTATTAA TCTCGGTTTA ATTGCTGGGA
TTCAAGGAAA AGAAAATACT GGGACAAGCG CGGATGTCGC TGTTGGGCAG TGTCTGTCAA TCATAAGCGA AGGGGATCAT
GTCAGAATCT GCAAAAGCAG CACAGGCTAA ACGCGTGCTT GCCTCGAGCA GCAATCATGC AGAGAGGCAA GCTCCGCGAT
AGGAACATGC ATGGTGAATC ACTGAACCTG ATATGAAAGT GAATGCTCAG CTCAGCTCGC TCGCTCGCGC GCGCATGTGC
TTTCTCATTT CGCCGTGTTG CGTGCTAGCT AGTCAATGGT GTTCCCACGA ATTGTTTTCT CTTCTCATCA CACAAAGTCA
GTGGTGAAAA CCGAGGTGCA TGTGCGGTAA TGGAACGGGG GATTAGGCGG CGACGCCGTG ATGGATTATG CATTCGTGCG
AGAAAAATCC AGGAGCGTTG GTCCAAATCG CAAGCGGATC AAACCGAACC AATCAGTGGA CGATTGGAGC CCTGCAGTCC
ATCCATCACA TCTCCATTCT TATCCGCTGC GACTCACGGA CATTAGTTGT TGAGGGGTGA ACGACGCATG TGTGTATGTA
TGCTCGATCG ATCGATCGAA CAATGGATCT GTGTGTGGTG TAGTTGCCAA CGCCGACGAG ATTATCTGCT CGTCTGCATG
CAGCCGCGAA AAAGACATGT GTCCGGATTA TCCTGCAGGA GATTGAGCAA GATAATCTGC TGCGCAAAAA CTGCAGCCAA
TCGATCATTC CATGACGCGA AAAAAAAAAC AATAATTACT ACTGCTGATA CGATAACTTC GCTTCGAATT GTTGACACAC
AAGTGTTCTT CTTTTGTTCG ATTGCAGAGT AGCGGATCAT CCGGCGGCTT GGctcagagc agcagcttca tgccgtacgg
cggcgggacg cggctgtgcg ccgggtcgga gctcgcgaag ctggagatgg ccgtgttctt gcaccacctg gtGCTCAACT
TCAGGTGGGA GCTCGCCGAG CCGGACCAAG CCTTCGTCTT CCCCTTCGTC GACTTCCCCA AGGGCCTTCC CATTAGGGTT
CATAGAATTG CACAGGATGA TGAGCAGGAG TAAAAAAAAG GAAAGAAAAA AAAGAAGAGC CTTTTGACCT AATTGTTGGA
TATATAAAAT CAAAAGGAAA TATCTAGGAA AGTACAGGAT GCATGTACAC GTTTTCGTTT TCGTTTTCCT TTTTTTTGGT
GGCAGTTTGT GCTATGTGTA GATGTGATCA GGAAAGGata tagtaagata gtagtaat

Locus: Os03g0227700

Loading...

Locus: Os03g0227700

Loading...