Os03t0228800-01

Locus

Os03g0228800

Description

Leucine-rich repeat receptor-like kinase, Rice blast resistance

RAP-DB Gene Symbol Synonym(s)

OsBRR1

RAP-DB Gene Name Synonym(s)

blast resistance-related gene

CGSNL Gene Symbol

BRR1

CGSNL Gene Name

BLAST RESISTANCE-RELATED 1

Oryzabase Gene Symbol Synonym(s)

OsBRR1

Oryzabase Gene Name Synonym(s)

blast resistance-related 1

Transcript Evidence

AK121286

Protein Evidence

Q10PM6

Literature

PMID: 19468748

Note

Manual Curation

November 2, 2020

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein binding (GO:0005515)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Leucine-rich repeat domain superfamily (IPR032675)

Protein kinase-like domain superfamily (IPR011009)

Leucine-rich repeat-containing N-terminal, plant-type (IPR013210)

Protein kinase domain (IPR000719)

Leucine-rich repeat, typical subtype (IPR003591)

Leucine-rich repeat (IPR001611)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

Full-length cDNA

J023108P09 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0228800-01)

RiceXPro (AK121286)

Others

Oryzabase (23762)

KEGG (Os03t0228800-01)

Transcript

3314 bp

>Os03t0228800-01 Leucine-rich repeat receptor-like kinase, Rice blast resistance
GGACACCCACTCCGCCACCGCCACCGCCTCATCCATGGCACTGGCTGGCTCCATGGCCGC
CGCCGCCGCCACCTCCACCCTTCTCCTCCTCCTCCTCCTCCTCCTCCTCGCCACCGCCAC
CCATGGCGCCGCGGCCGACACAGTCTCGTCCCCCGCCTCCCCTGAAGCGGCCGCACTCCT
CAACCTCTCCGCCGCGCTCGGTGATCCCTCGGGCTACCTCTCCACGCACTGGACGCACGA
CACCGCGTTCTGCTCGTGgccgcgcctctcctgcgacgccgacggctcccgcgtcctctc
gctcgacctctccggcctcaacctctccggcccgatccccgccgcggcgctctcctccct
ctcgcacctccagtcactcaacctctccaacaacatcctcaactccaccttcccggaggg
cctcatcgccagcctcaagaaccttcgcgttctcgatttctacaacaacaacctcaccgg
cgctctcccggccgcgctccccaacctcaccaaccttgttcacctccacctcggcggCAA
TTTCTTCTTCGGCAGCATCCCCAGGTCGTACGGGCAGTGGAGCCGGATCAAGTACCTGGC
TCTCTCCGGCAATGAGCTCACCGGGGAGATACCGCCGGAGCTCGGCAACCTGACGACGCT
CAGGGAACTGTACCTCGGCTACTTCAACAGCTTCACCGGCGGGATACCGCCGGAGCTCGG
GAGGCTGAAGGAGCTCGTGCGGCTCGACATGGCGAACTGCGGGATCTCCGGTGTGGTCCC
GCCGGAGGTGGCGAACCTGACGTCGCTCGACACTCTGTTTCTTCAGATCAACGCTCTCTC
CGGGCGGCTGCCGCCGGAGATTGGCGCAATGGGGGCGCTGAAATCGCTCGACCTGTCGAA
CAACCTGTTCGTCGGGGAGATCCCCGCGAGCTTCGCGTCGCTCAAGAACCTGACGCTGCT
GAACCTCTTCCGGAATCGCCTCGCCGGCGAGATTCCCGAGTTTGTCGGCGACCTGCCGAA
CCTCGAGGTGCTGCAGCTGTGGGAGAACAACTTCACCGGTGGAGTGCCGGCTCAGCTCGG
CGTGGCAGCCACCAGGCTGAGGATCGTCGATGTGAGCACGAACAGGCTAACCGGCGTTCT
ACCAACAGAGCTCTGCGCCGGCAAGCGGCTGGAGACGTTCATTGCGCTGGGGAACTCACT
GTTCGGCAGCATTCCCGACGGGCTCGCCGGGTGCCCGTCGTTGACGAGGCTTCGTCTTGG
AGAGAATTATCTGAACGGGACGATACCGGCGAAGATGTTTACATTGCAGAACCTGACGCA
GATCGAGCTGCACGATAATTTGCTCTCCGGCGAGCTCCGGCTGGACGCCGGCGTGGTGTC
ACCATCAATAGGAGAGCTGAGCTTGTATAACAATCGGTTGTCCGGTCCGGTGCCGGTGGG
GATCGGTGGTCTCGTCGGGCTGCAGAAGTTGCTGGTCGCCGGGAACCGGTTGTCCGGCGA
ACTCCCTCGTGAGATTGGGAAGCTGCAACAGCTTTCAAAGGCGGACTTATCTGggaacct
gatctccggggagatacctccggcgatcgccggatgccggctgctcaccttcctcgacct
ctctggcaacaggctctccggcagaatcccgccggcgctcgccgggctacgaatcctcaa
ctatctcaatctgtcccacaacgcgctcgacggggagattccacctgcTATCGCCGGAAT
GCAGAGCCTAACAGCCGTCGACTTCTCCGACAACAATCTCTCCGGCGAGGTCCCGGCGAC
CGGCCAGTTCGCCTACTTCAACGCCACGTCGTTCGCCGGTAACCCAGGCCTCTGCGGCGC
CTTCCTCTCCCCGTGCCGCTCCCACGGCGTCGCCACGACGTCGACCTTCGGCTCCCTCTC
GTCGGCGTCGAAGCTGCTCCTCGTGCTCGGCCTCCTCGCGCTGTCCATCGTGTTCGCCGG
CGCGGCGGTGCTGAAGGCGCGGTCGCTGAAGCGGTCCGCCGAGGCGCGCGCGTGGCGGCT
CACGGCGTTCCAGCGCCTCGACTTCGCCGTGGACGACGTGCTGGACTGCCTCAAGGAGGA
GAACGTGATCGGCAAGGGCGGGTCAGGGATCGTGTACAAGGGCGCGATGCCCGGCGGCGC
GGTGGTGGCCGTGAAGCGGCTCCCGGCCATGGGGCGCTCCGGCGCGGCGCACGACGACTA
CGGCTTCTCGGCGGAGATACAGACGCTGGGGCGCATCCGGCACCGACACATCGTGCGCCT
GCTCGGGTTCGCCGCCAACCGGGAGACGAACCTGCTGGTGTACGAGTACATGCCGAACGG
CAGCCTCGGCGAGGTGCTCCACGGCAAGAAGGGCGGCCACCTGCAGTGGGCGACGCGGTA
CAAGATCGCCGTGGAGGCCGCCAagggcctctgctacctgcaccacgactgctcgccgcc
gatcctgcaccgcgacgtcaagtccaacaacatcctcctcgacgccgagttcgaggcgca
cgtcgccgacttcggCCTCGCCAAGTTCCTCCGCGGCAATGCCGGTGGCTCCGAGTGCAT
GTCCGCGATCGCCGGCTCCTACGGCTACATTGCTCCCGagtacgcctacacgctcaaggt
ggacgagaagagcgacgtgtacagcttcggggtagtgctactggagctcatCGCTGGGCG
GAAGCCGGTGGGAGAGTTCGGCGACGGCGTGGACATCGTGCACTGGGTGCGGATGGTGAC
CGGGTCGAGCAAGGAGGGCGTCACGAAGATCGCCGACCCACGGCTCTCGACGGTGCCCCT
CCACGAGCTGACGCACGTCTTCTACGTCGCCATGCTGTGCGTCGCCGAGCAGAGCGTCGA
GCGGCCGACGATGCGGGAGGTCGTGCAGATCTTGACCGACCTGCCCGGTACGGCGGCGGC
GACGGCCATGGACGCGCCGTCGCACGGGTCGGGGAAAGAGCAAGACCGGAGCGCGGAGAT
GCAGCAGCAGGACGGGTCACGCGAGTCCCCGCCACAGCAGGATCTCCTTAGCATCTAGAA
GCGTGCGTGCATGTCCCCGTTGTACCGGTACTCCGTAGCATCATCCCCTGTACGTCTTGG
CGTACTCCTGGACTGTGCTGGTGTCCTGGACTGTGCTGGTGTCCGGGTCCGAGTCCAAGT
AGAGGCAAATCTCCAATATTTGCGGTAGTATTGTTAGCTAGATTAAGATTATATTGTTAC
ATAATGGTGGTTGATAAAATCTACTACTAGTAGTATGTAATCTGTCTCCTCTCGTGTACA
AAGCAACTACTCCT

CDS

3024 bp

>Os03t0228800-01 Leucine-rich repeat receptor-like kinase, Rice blast resistance
ATGGCACTGGCTGGCTCCATGGCCGCCGCCGCCGCCACCTCCACCCTTCTCCTCCTCCTC
CTCCTCCTCCTCCTCGCCACCGCCACCCATGGCGCCGCGGCCGACACAGTCTCGTCCCCC
GCCTCCCCTGAAGCGGCCGCACTCCTCAACCTCTCCGCCGCGCTCGGTGATCCCTCGGGC
TACCTCTCCACGCACTGGACGCACGACACCGCGTTCTGCTCGTGgccgcgcctctcctgc
gacgccgacggctcccgcgtcctctcgctcgacctctccggcctcaacctctccggcccg
atccccgccgcggcgctctcctccctctcgcacctccagtcactcaacctctccaacaac
atcctcaactccaccttcccggagggcctcatcgccagcctcaagaaccttcgcgttctc
gatttctacaacaacaacctcaccggcgctctcccggccgcgctccccaacctcaccaac
cttgttcacctccacctcggcggCAATTTCTTCTTCGGCAGCATCCCCAGGTCGTACGGG
CAGTGGAGCCGGATCAAGTACCTGGCTCTCTCCGGCAATGAGCTCACCGGGGAGATACCG
CCGGAGCTCGGCAACCTGACGACGCTCAGGGAACTGTACCTCGGCTACTTCAACAGCTTC
ACCGGCGGGATACCGCCGGAGCTCGGGAGGCTGAAGGAGCTCGTGCGGCTCGACATGGCG
AACTGCGGGATCTCCGGTGTGGTCCCGCCGGAGGTGGCGAACCTGACGTCGCTCGACACT
CTGTTTCTTCAGATCAACGCTCTCTCCGGGCGGCTGCCGCCGGAGATTGGCGCAATGGGG
GCGCTGAAATCGCTCGACCTGTCGAACAACCTGTTCGTCGGGGAGATCCCCGCGAGCTTC
GCGTCGCTCAAGAACCTGACGCTGCTGAACCTCTTCCGGAATCGCCTCGCCGGCGAGATT
CCCGAGTTTGTCGGCGACCTGCCGAACCTCGAGGTGCTGCAGCTGTGGGAGAACAACTTC
ACCGGTGGAGTGCCGGCTCAGCTCGGCGTGGCAGCCACCAGGCTGAGGATCGTCGATGTG
AGCACGAACAGGCTAACCGGCGTTCTACCAACAGAGCTCTGCGCCGGCAAGCGGCTGGAG
ACGTTCATTGCGCTGGGGAACTCACTGTTCGGCAGCATTCCCGACGGGCTCGCCGGGTGC
CCGTCGTTGACGAGGCTTCGTCTTGGAGAGAATTATCTGAACGGGACGATACCGGCGAAG
ATGTTTACATTGCAGAACCTGACGCAGATCGAGCTGCACGATAATTTGCTCTCCGGCGAG
CTCCGGCTGGACGCCGGCGTGGTGTCACCATCAATAGGAGAGCTGAGCTTGTATAACAAT
CGGTTGTCCGGTCCGGTGCCGGTGGGGATCGGTGGTCTCGTCGGGCTGCAGAAGTTGCTG
GTCGCCGGGAACCGGTTGTCCGGCGAACTCCCTCGTGAGATTGGGAAGCTGCAACAGCTT
TCAAAGGCGGACTTATCTGggaacctgatctccggggagatacctccggcgatcgccgga
tgccggctgctcaccttcctcgacctctctggcaacaggctctccggcagaatcccgccg
gcgctcgccgggctacgaatcctcaactatctcaatctgtcccacaacgcgctcgacggg
gagattccacctgcTATCGCCGGAATGCAGAGCCTAACAGCCGTCGACTTCTCCGACAAC
AATCTCTCCGGCGAGGTCCCGGCGACCGGCCAGTTCGCCTACTTCAACGCCACGTCGTTC
GCCGGTAACCCAGGCCTCTGCGGCGCCTTCCTCTCCCCGTGCCGCTCCCACGGCGTCGCC
ACGACGTCGACCTTCGGCTCCCTCTCGTCGGCGTCGAAGCTGCTCCTCGTGCTCGGCCTC
CTCGCGCTGTCCATCGTGTTCGCCGGCGCGGCGGTGCTGAAGGCGCGGTCGCTGAAGCGG
TCCGCCGAGGCGCGCGCGTGGCGGCTCACGGCGTTCCAGCGCCTCGACTTCGCCGTGGAC
GACGTGCTGGACTGCCTCAAGGAGGAGAACGTGATCGGCAAGGGCGGGTCAGGGATCGTG
TACAAGGGCGCGATGCCCGGCGGCGCGGTGGTGGCCGTGAAGCGGCTCCCGGCCATGGGG
CGCTCCGGCGCGGCGCACGACGACTACGGCTTCTCGGCGGAGATACAGACGCTGGGGCGC
ATCCGGCACCGACACATCGTGCGCCTGCTCGGGTTCGCCGCCAACCGGGAGACGAACCTG
CTGGTGTACGAGTACATGCCGAACGGCAGCCTCGGCGAGGTGCTCCACGGCAAGAAGGGC
GGCCACCTGCAGTGGGCGACGCGGTACAAGATCGCCGTGGAGGCCGCCAagggcctctgc
tacctgcaccacgactgctcgccgccgatcctgcaccgcgacgtcaagtccaacaacatc
ctcctcgacgccgagttcgaggcgcacgtcgccgacttcggCCTCGCCAAGTTCCTCCGC
GGCAATGCCGGTGGCTCCGAGTGCATGTCCGCGATCGCCGGCTCCTACGGCTACATTGCT
CCCGagtacgcctacacgctcaaggtggacgagaagagcgacgtgtacagcttcggggta
gtgctactggagctcatCGCTGGGCGGAAGCCGGTGGGAGAGTTCGGCGACGGCGTGGAC
ATCGTGCACTGGGTGCGGATGGTGACCGGGTCGAGCAAGGAGGGCGTCACGAAGATCGCC
GACCCACGGCTCTCGACGGTGCCCCTCCACGAGCTGACGCACGTCTTCTACGTCGCCATG
CTGTGCGTCGCCGAGCAGAGCGTCGAGCGGCCGACGATGCGGGAGGTCGTGCAGATCTTG
ACCGACCTGCCCGGTACGGCGGCGGCGACGGCCATGGACGCGCCGTCGCACGGGTCGGGG
AAAGAGCAAGACCGGAGCGCGGAGATGCAGCAGCAGGACGGGTCACGCGAGTCCCCGCCA
CAGCAGGATCTCCTTAGCATCTAG

Protein

1008 aa

>Os03t0228800-01 Leucine-rich repeat receptor-like kinase, Rice blast resistance
MALAGSMAAAAATSTLLLLLLLLLLATATHGAAADTVSSPASPEAAALLNLSAALGDPSG
YLSTHWTHDTAFCSWPRLSCDADGSRVLSLDLSGLNLSGPIPAAALSSLSHLQSLNLSNN
ILNSTFPEGLIASLKNLRVLDFYNNNLTGALPAALPNLTNLVHLHLGGNFFFGSIPRSYG
QWSRIKYLALSGNELTGEIPPELGNLTTLRELYLGYFNSFTGGIPPELGRLKELVRLDMA
NCGISGVVPPEVANLTSLDTLFLQINALSGRLPPEIGAMGALKSLDLSNNLFVGEIPASF
ASLKNLTLLNLFRNRLAGEIPEFVGDLPNLEVLQLWENNFTGGVPAQLGVAATRLRIVDV
STNRLTGVLPTELCAGKRLETFIALGNSLFGSIPDGLAGCPSLTRLRLGENYLNGTIPAK
MFTLQNLTQIELHDNLLSGELRLDAGVVSPSIGELSLYNNRLSGPVPVGIGGLVGLQKLL
VAGNRLSGELPREIGKLQQLSKADLSGNLISGEIPPAIAGCRLLTFLDLSGNRLSGRIPP
ALAGLRILNYLNLSHNALDGEIPPAIAGMQSLTAVDFSDNNLSGEVPATGQFAYFNATSF
AGNPGLCGAFLSPCRSHGVATTSTFGSLSSASKLLLVLGLLALSIVFAGAAVLKARSLKR
SAEARAWRLTAFQRLDFAVDDVLDCLKEENVIGKGGSGIVYKGAMPGGAVVAVKRLPAMG
RSGAAHDDYGFSAEIQTLGRIRHRHIVRLLGFAANRETNLLVYEYMPNGSLGEVLHGKKG
GHLQWATRYKIAVEAAKGLCYLHHDCSPPILHRDVKSNNILLDAEFEAHVADFGLAKFLR
GNAGGSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVD
IVHWVRMVTGSSKEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQSVERPTMREVVQIL
TDLPGTAAATAMDAPSHGSGKEQDRSAEMQQQDGSRESPPQQDLLSI*

5'UTR

chr03:6808313..6808346 (- strand) : 34 bp

CDS

chr03:6805729..6808312 (- strand) : 2584 bp

chr03:6804875..6805314 (- strand) : 440 bp

3'UTR

chr03:6804619..6804874 (- strand) : 256 bp

FASTA

>Os03t0228800-01 class=Sequence position=chr03:6804619..6808346 (- strand)
GGACACCCAC TCCGCCACCG CCACCGCCTC ATCCATGGCA CTGGCTGGCT CCATGGCCGC CGCCGCCGCC ACCTCCACCC
TTCTCCTCCT CCTCCTCCTC CTCCTCCTCG CCACCGCCAC CCATGGCGCC GCGGCCGACA CAGTCTCGTC CCCCGCCTCC
CCTGAAGCGG CCGCACTCCT CAACCTCTCC GCCGCGCTCG GTGATCCCTC GGGCTACCTC TCCACGCACT GGACGCACGA
CACCGCGTTC TGCTCGTGgc cgcgcctctc ctgcgacgcc gacggctccc gcgtcctctc gctcgacctc tccggcctca
acctctccgg cccgatcccc gccgcggcgc tctcctccct ctcgcacctc cagtcactca acctctccaa caacatcctc
aactccacct tcccggaggg cctcatcgcc agcctcaaga accttcgcgt tctcgatttc tacaacaaca acctcaccgg
cgctctcccg gccgcgctcc ccaacctcac caaccttgtt cacctccacc tcggcggCAA TTTCTTCTTC GGCAGCATCC
CCAGGTCGTA CGGGCAGTGG AGCCGGATCA AGTACCTGGC TCTCTCCGGC AATGAGCTCA CCGGGGAGAT ACCGCCGGAG
CTCGGCAACC TGACGACGCT CAGGGAACTG TACCTCGGCT ACTTCAACAG CTTCACCGGC GGGATACCGC CGGAGCTCGG
GAGGCTGAAG GAGCTCGTGC GGCTCGACAT GGCGAACTGC GGGATCTCCG GTGTGGTCCC GCCGGAGGTG GCGAACCTGA
CGTCGCTCGA CACTCTGTTT CTTCAGATCA ACGCTCTCTC CGGGCGGCTG CCGCCGGAGA TTGGCGCAAT GGGGGCGCTG
AAATCGCTCG ACCTGTCGAA CAACCTGTTC GTCGGGGAGA TCCCCGCGAG CTTCGCGTCG CTCAAGAACC TGACGCTGCT
GAACCTCTTC CGGAATCGCC TCGCCGGCGA GATTCCCGAG TTTGTCGGCG ACCTGCCGAA CCTCGAGGTG CTGCAGCTGT
GGGAGAACAA CTTCACCGGT GGAGTGCCGG CTCAGCTCGG CGTGGCAGCC ACCAGGCTGA GGATCGTCGA TGTGAGCACG
AACAGGCTAA CCGGCGTTCT ACCAACAGAG CTCTGCGCCG GCAAGCGGCT GGAGACGTTC ATTGCGCTGG GGAACTCACT
GTTCGGCAGC ATTCCCGACG GGCTCGCCGG GTGCCCGTCG TTGACGAGGC TTCGTCTTGG AGAGAATTAT CTGAACGGGA
CGATACCGGC GAAGATGTTT ACATTGCAGA ACCTGACGCA GATCGAGCTG CACGATAATT TGCTCTCCGG CGAGCTCCGG
CTGGACGCCG GCGTGGTGTC ACCATCAATA GGAGAGCTGA GCTTGTATAA CAATCGGTTG TCCGGTCCGG TGCCGGTGGG
GATCGGTGGT CTCGTCGGGC TGCAGAAGTT GCTGGTCGCC GGGAACCGGT TGTCCGGCGA ACTCCCTCGT GAGATTGGGA
AGCTGCAACA GCTTTCAAAG GCGGACTTAT CTGggaacct gatctccggg gagatacctc cggcgatcgc cggatgccgg
ctgctcacct tcctcgacct ctctggcaac aggctctccg gcagaatccc gccggcgctc gccgggctac gaatcctcaa
ctatctcaat ctgtcccaca acgcgctcga cggggagatt ccacctgcTA TCGCCGGAAT GCAGAGCCTA ACAGCCGTCG
ACTTCTCCGA CAACAATCTC TCCGGCGAGG TCCCGGCGAC CGGCCAGTTC GCCTACTTCA ACGCCACGTC GTTCGCCGGT
AACCCAGGCC TCTGCGGCGC CTTCCTCTCC CCGTGCCGCT CCCACGGCGT CGCCACGACG TCGACCTTCG GCTCCCTCTC
GTCGGCGTCG AAGCTGCTCC TCGTGCTCGG CCTCCTCGCG CTGTCCATCG TGTTCGCCGG CGCGGCGGTG CTGAAGGCGC
GGTCGCTGAA GCGGTCCGCC GAGGCGCGCG CGTGGCGGCT CACGGCGTTC CAGCGCCTCG ACTTCGCCGT GGACGACGTG
CTGGACTGCC TCAAGGAGGA GAACGTGATC GGCAAGGGCG GGTCAGGGAT CGTGTACAAG GGCGCGATGC CCGGCGGCGC
GGTGGTGGCC GTGAAGCGGC TCCCGGCCAT GGGGCGCTCC GGCGCGGCGC ACGACGACTA CGGCTTCTCG GCGGAGATAC
AGACGCTGGG GCGCATCCGG CACCGACACA TCGTGCGCCT GCTCGGGTTC GCCGCCAACC GGGAGACGAA CCTGCTGGTG
TACGAGTACA TGCCGAACGG CAGCCTCGGC GAGGTGCTCC ACGGCAAGAA GGGCGGCCAC CTGCAGTGGG CGACGCGGTA
CAAGATCGCC GTGGAGGCCG CCAagggcct ctgctacctg caccacgact gctcgccgcc gatcctgcac cgcgacgtca
agtccaacaa catcctcctc gacgccgagt tcgaggcgca cgtcgccgac ttcggCCTCG CCAAGTTCCT CCGCGGCAAT
GCCGGTGGCT CCGAGTGCAT GTCCGCGATC GCCGGCTCCT ACGGCTACAT TGCTCCCGGT ATGTATGAGT GTACCCCCTC
TGCCCCCTAC AAATTTTCAG CTCATTCTGT TGACTGTACC CGGTTGCTAC TAGTACTACT ATCCACCATC ATTTCCAGTG
TTGAAAAAAT CATGCATCAC AAAGTGCAGA AAAGGCCCAA AATTGCTAGT ACTAGTCCTG TCCTGCTCAT GGCAAATGTT
ACAATGGGGC CTTCATATTT TTCAAACTCA CTATCACATT GAAATTTGGA AGAAAATGGT TGGTTTTGGT ATGCTCTGAT
TTGTTTTTTA CTGTGCCCCC ACACTATCGA GTTGTACATA TGCTGGATGT TGTGCCTCTC GTCACTTTGT CGTTTTAATG
AATCATCATT GGGAATTGAT GGCCTGCGAT CTTATGTGGT CTGAGCTGTG TGTTTGCCCT GTGCATCCgc agagtacgcc
tacacgctca aggtggacga gaagagcgac gtgtacagct tcggggtagt gctactggag ctcatCGCTG GGCGGAAGCC
GGTGGGAGAG TTCGGCGACG GCGTGGACAT CGTGCACTGG GTGCGGATGG TGACCGGGTC GAGCAAGGAG GGCGTCACGA
AGATCGCCGA CCCACGGCTC TCGACGGTGC CCCTCCACGA GCTGACGCAC GTCTTCTACG TCGCCATGCT GTGCGTCGCC
GAGCAGAGCG TCGAGCGGCC GACGATGCGG GAGGTCGTGC AGATCTTGAC CGACCTGCCC GGTACGGCGG CGGCGACGGC
CATGGACGCG CCGTCGCACG GGTCGGGGAA AGAGCAAGAC CGGAGCGCGG AGATGCAGCA GCAGGACGGG TCACGCGAGT
CCCCGCCACA GCAGGATCTC CTTAGCATCT AGAAGCGTGC GTGCATGTCC CCGTTGTACC GGTACTCCGT AGCATCATCC
CCTGTACGTC TTGGCGTACT CCTGGACTGT GCTGGTGTCC TGGACTGTGC TGGTGTCCGG GTCCGAGTCC AAGTAGAGGC
AAATCTCCAA TATTTGCGGT AGTATTGTTA GCTAGATTAA GATTATATTG TTACATAATG GTGGTTGATA AAATCTACTA
CTAGTAGTAT GTAATCTGTC TCCTCTCGTG TACAAAGCAA CTACTCCT

Locus: Os03g0228800

Loading...

Locus: Os03g0228800

Loading...