Os03t0230500-01

Locus

Os03g0230500

Description

Inositol 1,3,4-trisphosphate 5/6-kinase, Drought and salt tolerance, Negative regulator of osmotic stress signaling

RAP-DB Gene Symbol Synonym(s)

DSM3, DSM3/OsITPK2, OsITL1, OsITPK2

RAP-DB Gene Name Synonym(s)

3, 4-trisphosphate 5/6-kinase 2, DROUGHT- AND SALT-SENSITIVE MUTANT 3, drought- and salt-hypersensitive mutant 3, inositol 1

CGSNL Gene Symbol

DSM3

CGSNL Gene Name

DROUGHT- AND SALT-SENSITIVE MUTANT 3

Oryzabase Gene Symbol Synonym(s)

OsITPK2, ITPK2, OsDSM3, OsITP5/6K-2, OsITL1

Oryzabase Gene Name Synonym(s)

inositol 1, 3, 4-trisphosphate 5/6-kinase 2, drought- and salt-sensitive mutant 3

Transcript Evidence

AK100971

AY323825 (Zhongzuo93)

Protein Evidence

Q10PL5

Literature

PMID: 22038091

PMID: 18421420

Note

Manual Curation

May 8, 2017

Gene Ontology (GO)

Biological Process: inositol trisphosphate metabolic process (GO:0032957)

Molecular Function: magnesium ion binding (GO:0000287)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: inositol tetrakisphosphate 1-kinase activity (GO:0047325)

Molecular Function: inositol-1,3,4-trisphosphate 6-kinase activity (GO:0052725)

Molecular Function: inositol-1,3,4-trisphosphate 5-kinase activity (GO:0052726)

Cellular Component: intracellular (GO:0005622)

Functional domain (InterPro)

Inositol-tetrakisphosphate 1-kinase (IPR008656)

Experimentally confirmed subcellular location

endoplasmic reticulum (GO:0005783)

Full-length cDNA

J023143C13 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0230500-01)

RiceXPro (AK100971)

Others

Oryzabase (11437)

KEGG (Os03t0230500-01 (EC:2.7.1.134)

KEGG ( EC:2.7.1.159))

Transcript

1586 bp

>Os03t0230500-01 Inositol 1,3,4-trisphosphate 5/6-kinase, Drought and salt tolerance, Negative regulator of osmotic stress signaling
TTCCACTCGTCTCGCCATTAACAAGAATTCTTTTTTTCCTTCCCCCAAATCCTTCTCGAG
CAACAGCTAGGGGGGAGTGGTTCGCTTCGTAAGAAGCCGGCTACCTCTGCTCGATCCCGC
CTTTGCCTGCGGATTCCCACCCTGATTTTCGCCGTTTGTTTGTTTAGTTTCTTGGGGCAA
ATTCGAGACGAGGGGAGGAGAGTTTTTTTGGGGGGGAGTTGTTGCGGCCTTGCGGGCGGG
GTATGCGGCTGCACGGGGAGGTTTCCTTCGATGAGGACGAGGAGGAAGTGGTGATGGTTC
CGGCGGCGGCGCTGTCGTCGTCGCCGCTCAACGGCGGGGCCGTTCCGGTGACGAGGCTCG
TGGTGGGGTACGCCCTCACCAAGAAGAAGGTGAAGAGCTTCCTTCAGCCCAATCTGCTGT
TGCTGGCGAGGAAGAAGGGAATTAATCTTGTAGCAATTGATGACACTCGCCCGCTTGCAG
AACAAGGCCCATTTGATGTTATCTTGCACAAGATTACTAGCAAGGAATGGCAACAGGTTC
TGGAGGATTATCATGAGGAACATCCAGAGGTTACTGTCCTTGACCCACCAAATGCCATCA
ATCATCTGAATAATCGGCAATCTATGCTTGCAGAAGTATCTGATTTGAACTTATCCAGTT
TCTATGGAGAAGTTTGCACTCCACGCCAACTGGTCATTATGAGAGATCCATCCTCTATAC
CAACCGCAGTTGCCATGGCTGGACTAACCTTGCCCTTGGTTGCGAAGCCATTGGTTGTTG
ATGGAACATCTAAATCCCACGAACTATCTCTTGCATATGATGAGGCATCCTTATCAATGC
TTGATCCTCCTCTGGTCCTCCAGGAATTTGTGAACCATGGTGGGATCCTCTTTAAGGTGT
ACATCATTGGTGAAACTATACAAGTTGTACGGAGGTTTTCTCTTCCTGATGTTAACACTT
ATGACTTATTAAACAATGTTGGCGTCTATCGATTTCCAAGAGTTTCATGTGCTGCAGCTA
GTGCAGACCATGCAGACCTCGATCCTCATATCTCAGAACTTCCTCCAAGACCACTCCTAG
AGAAACTGGGAAAAGAGCTTCGTGGAAGACTGGGTTTAAGATTGTTCAACATAGATATGA
TCAGAGAACTTGGAACCAAAGATCGGTACTATATAATTGACATCAACTACTTCCCAGGGT
TCGGGAAAATGCCAGGTTATGAGCACATATTCACCGATTTCTTGCTGAATCTTGCGCAAA
GCAAGTACAAGAAGTGCTTAAGCGGCGGCTGAAGTGCAAAGAGTCCTGCTGAACATTAAC
AAAATGGAATGTAACGGTCTAGCAGTCAGTGTACATATCTCGGAGAAATAAGTTTAATCC
CAAGGCTTTGAGGAAGAGAGATTTAGGGTGTCTTCCCAGAAAATGGTGGCACTTACCGGA
TTAGAGAAGAGATGAAAAAATGGATCGATTTTCTAATGCCGAGTGCTTGTATAAATCACT
AACACTGAATGTTCCCAGCGTGCCTTCGTCAAGGCTTCTGTCTCAATAATTTCATTATCT
TTTTCATGAGCAATCCTTTTAGAATG

CDS

1050 bp

>Os03t0230500-01 Inositol 1,3,4-trisphosphate 5/6-kinase, Drought and salt tolerance, Negative regulator of osmotic stress signaling
ATGCGGCTGCACGGGGAGGTTTCCTTCGATGAGGACGAGGAGGAAGTGGTGATGGTTCCG
GCGGCGGCGCTGTCGTCGTCGCCGCTCAACGGCGGGGCCGTTCCGGTGACGAGGCTCGTG
GTGGGGTACGCCCTCACCAAGAAGAAGGTGAAGAGCTTCCTTCAGCCCAATCTGCTGTTG
CTGGCGAGGAAGAAGGGAATTAATCTTGTAGCAATTGATGACACTCGCCCGCTTGCAGAA
CAAGGCCCATTTGATGTTATCTTGCACAAGATTACTAGCAAGGAATGGCAACAGGTTCTG
GAGGATTATCATGAGGAACATCCAGAGGTTACTGTCCTTGACCCACCAAATGCCATCAAT
CATCTGAATAATCGGCAATCTATGCTTGCAGAAGTATCTGATTTGAACTTATCCAGTTTC
TATGGAGAAGTTTGCACTCCACGCCAACTGGTCATTATGAGAGATCCATCCTCTATACCA
ACCGCAGTTGCCATGGCTGGACTAACCTTGCCCTTGGTTGCGAAGCCATTGGTTGTTGAT
GGAACATCTAAATCCCACGAACTATCTCTTGCATATGATGAGGCATCCTTATCAATGCTT
GATCCTCCTCTGGTCCTCCAGGAATTTGTGAACCATGGTGGGATCCTCTTTAAGGTGTAC
ATCATTGGTGAAACTATACAAGTTGTACGGAGGTTTTCTCTTCCTGATGTTAACACTTAT
GACTTATTAAACAATGTTGGCGTCTATCGATTTCCAAGAGTTTCATGTGCTGCAGCTAGT
GCAGACCATGCAGACCTCGATCCTCATATCTCAGAACTTCCTCCAAGACCACTCCTAGAG
AAACTGGGAAAAGAGCTTCGTGGAAGACTGGGTTTAAGATTGTTCAACATAGATATGATC
AGAGAACTTGGAACCAAAGATCGGTACTATATAATTGACATCAACTACTTCCCAGGGTTC
GGGAAAATGCCAGGTTATGAGCACATATTCACCGATTTCTTGCTGAATCTTGCGCAAAGC
AAGTACAAGAAGTGCTTAAGCGGCGGCTGA

Protein

350 aa

>Os03t0230500-01 Inositol 1,3,4-trisphosphate 5/6-kinase, Drought and salt tolerance, Negative regulator of osmotic stress signaling
MRLHGEVSFDEDEEEVVMVPAAALSSSPLNGGAVPVTRLVVGYALTKKKVKSFLQPNLLL
LARKKGINLVAIDDTRPLAEQGPFDVILHKITSKEWQQVLEDYHEEHPEVTVLDPPNAIN
HLNNRQSMLAEVSDLNLSSFYGEVCTPRQLVIMRDPSSIPTAVAMAGLTLPLVAKPLVVD
GTSKSHELSLAYDEASLSMLDPPLVLQEFVNHGGILFKVYIIGETIQVVRRFSLPDVNTY
DLLNNVGVYRFPRVSCAAASADHADLDPHISELPPRPLLEKLGKELRGRLGLRLFNIDMI
RELGTKDRYYIIDINYFPGFGKMPGYEHIFTDFLLNLAQSKYKKCLSGG*

5'UTR

chr03:6902118..6902359 (+ strand) : 242 bp

CDS

chr03:6902360..6902547 (+ strand) : 188 bp

chr03:6903962..6904043 (+ strand) : 82 bp

chr03:6904230..6904262 (+ strand) : 33 bp

chr03:6904562..6904682 (+ strand) : 121 bp

chr03:6905453..6905545 (+ strand) : 93 bp

chr03:6905832..6905951 (+ strand) : 120 bp

chr03:6906051..6906227 (+ strand) : 177 bp

chr03:6906512..6906567 (+ strand) : 56 bp

chr03:6906640..6906724 (+ strand) : 85 bp

chr03:6907021..6907115 (+ strand) : 95 bp

3'UTR

chr03:6907116..6907409 (+ strand) : 294 bp

FASTA

>Os03t0230500-01 class=Sequence position=chr03:6902118..6907409 (+ strand)
TTCCACTCGT CTCGCCATTA ACAAGAATTC TTTTTTTCCT TCCCCCAAAT CCTTCTCGAG CAACAGCTAG GGGGGAGTGG
TTCGCTTCGT AAGAAGCCGG CTACCTCTGC TCGATCCCGC CTTTGCCTGC GGATTCCCAC CCTGATTTTC GCCGTTTGTT
TGTTTAGTTT CTTGGGGCAA ATTCGAGACG AGGGGAGGAG AGTTTTTTTG GGGGGGAGTT GTTGCGGCCT TGCGGGCGGG
GTATGCGGCT GCACGGGGAG GTTTCCTTCG ATGAGGACGA GGAGGAAGTG GTGATGGTTC CGGCGGCGGC GCTGTCGTCG
TCGCCGCTCA ACGGCGGGGC CGTTCCGGTG ACGAGGCTCG TGGTGGGGTA CGCCCTCACC AAGAAGAAGG TGAAGAGCTT
CCTTCAGCCC AATCTGCTGT TGCTGGCGAG GTAAAAACCT GGATCAACGC TCAAAGAGAT GAACCTGCTG ATTCGTGGCC
GTGGTGGAGG ATTTTGGGAG ACAATAGAGT ATTTTTGTTG GATTTCTTGT TGATCGAGTG GCAACGAAAT TTTTTTCACT
AAAACCAGAA TTTTTTGCTG TTGGAGGGAA ATGGTAAATG ATTTGAGGGG GGAATGCATG GTTTATGAGA TACAGTTTTG
CATTTTGAGT CTTTGATTAA ATGCTGTAAT TGGTTCTATT TCTGAAGCCC AGAGGATTTT TGCGAGAACA GGTAAAAAAC
TTGGTAGTTC CATAACAAAA TGGGGGGTGG GAATGGAATG CAATTCTATT CCTTGTAGCA CTAATCAAGT AGTGATCGAA
TCGAACCTCT ACTGGAGTAT AAAGTTAGCA GGGGCGGCTA GTGATAGTGG ATTCTGGGCG AAGCTTGCTG CATTTGCGAT
ATATTGTAAA CTGAAGAATA TGGCTAGTGT TTATTAGGAA TTCTGGTAGC ATTTGTAGAT GCCCCCTTAC GTGCGTCTCA
TGTTGACAGT TCCACTGCAT GCGGGGGTCT CTATAGTCTA TAATTGTATA TTATCATGCC AACTTGTCAA AAATGGGTCT
TAGCATGCAA ATCTTTGCTA CTTGGTGTCT GGGATTCTAG TTTGGAATAT TCCCATAATC CCATGGATAA GCACATCACA
TGGATTACGA CAGCTTTAGT GATGGCAATG CCTTTTCTGG GATCGTTTAC AATTTAGTGA CTGACTTGCT AGGTTTGATG
GCAACATGGA CCGCTGACAA ACGATCTTTG TGATTGTCTT GTTAGCTCCC TGAATCAAGA TCCAAGCTGA CTAGCTGAGT
CAATCATTTG CTAGTTGCTC GGTAGGCTGC AGACATAAGC AACACAAGCT GAAATATAGA AGGGAAATGA AATTAATATA
TGAAATACTT ATGCAAAATC AAAATGTTTT TGCTTAAAAC TATTTGTGTA TTGCATGCCT AGTTTGTGCT TTTGTTTCGA
TAGATTTATT GTTTAGTTAT TCCAAGAAAA TAAAGGAAAC AATATATATT TATGCAAAAT CCAACTATAT TCATTCAAAC
AACCTGCATA TTCTCTAAAC GCTTTTTTAT ATCCCTGTAG TAGTCTTATT TTCAAAGTAT AATTGAGAAA TACTCTGTTG
CAAGGCAGTT TAACTTTTTT TTATCATTCT TATTTATACT ATCGATAGAG TATAAATGTA GCCCAAACGA CATGTTATAC
ATGGAGAGAT GATGATGTAC TAAAAAAATT CTTGATTCTG TGAGGGCTTG GACTTGGTCA AGATGGCTAT TGTACTTCCA
TATGGATGTT AGGATCCATT TCTGTTTCTT GCCATTCTTC TTGTATAACA CTATTTCATG ATGTTTCATT ATGTACTGTG
TCAGGAAGAA GGGAATTAAT CTTGTAGCAA TTGATGACAC TCGCCCGCTT GCAGAACAAG GCCCATTTGA TGTTATCTTG
CACAAGGTTA GTCGTGACCT TTTTAAAGCT GGACTAAAAT AGTGCTGCCC ATTGGCCCTG TATGATGCAT TTTGTTAAAG
AATAACATCA TCTATTTATG AGCTTTAGTT ATAATTAATG TTTTCTGATA ATTATGTCAT TGTAATTTGG TAAAGTATAT
GCATATTTTA TTGAAGAAAT TTCTTTGTGC AGATTACTAG CAAGGAATGG CAACAGGTTC TGGAGGTAAG ATCTGAGTAC
GTATGCAGAA ATCTGATGAT GCACAGTAAA TGACCATACC ATCGTTGCCT TTTTTCTACT TGTTCACTGC CTCATCATGG
GGAAATATGT TATCAACTGA GGAAATGAGC AGTAGATGTT TGTCACTGTA TGTAATGATT ATATATCCAA ACTATTTGAT
TGCAGTGCCC TATTGTAAAG CTCAACATAA ATCCATAATT CTTGGAATTT GCTGTTGGCT TCTAATCTGT GTTGCCCATT
TATTGAAACT CTCTGTTAAC CTAACTCCTT TCACTTTCCT GAAGGATTAT CATGAGGAAC ATCCAGAGGT TACTGTCCTT
GACCCACCAA ATGCCATCAA TCATCTGAAT AATCGGCAAT CTATGCTTGC AGAAGTATCT GATTTGAACT TATCCAGTTT
CTATGGTAAT CATGAAGCTT AACATGTATA TTTATATGCT ATAAAATGGA TTCGTTATTT TACTTTCCAT TTCTAATGTT
TATAATGTTA GTTAGTGTCT GTTTAATTAT CGAATATATT CACATGTCAG GGAAGCACTG GTCATGTGGT GTAGTCGTAG
GTACTCCACC TGCCAGGGTT CAAATCCTGA TGCTCACGAA TATTATGCAC ACCCAAGTGG GCTTTCACTA GAAACTTAGT
GAGATCAGCG ATTGTCGTTG GTTTCTGTCT CTTAGAGTGT GTGTTAGGGG CGCATCAGTT GAGTTAGTGT GGTGCGCGCG
CGTGTGCGTC TGCCGTGTAG TCGCAAAAAA GAAAAATATA TTCACATTTA AACTTCTGTC CTAGAATGGA AGAAACTTTT
GCTTTCAAAA GCGATGTGCA GAATATTTAT CCTTCTAAGA TAAACAATAT ATATTTTCTA TTCCTTGTGA ACCTCAGGAT
TCAGGAATTT CCAATTAATG CTGCTATGTA ATTCTTTCTT CAAACAAAAG AAATTTGTGT TAACTCTTAG AAATGCTGAA
ATTCCCAATA GAAACCCATA GATTTTTTTG CTTTGCAGAG ATTTCAAGGA CAAATGTTGC TTGATTGGGA AACATTATTT
CTTTGCAGCT GGTTGTGAAT ACAATGTACC GAGATAGTAA AAGGCAGAAT TCCAAAAGTG TATCATCAAC TAAATCTATT
GAGGGCATAT CTATTCATAC CAATATATGA TTGTTTATGC ATTGAACCAT TGCAGGAGAA GTTTGCACTC CACGCCAACT
GGTCATTATG AGAGATCCAT CCTCTATACC AACCGCAGTT GCCATGGCTG GACTAACCTT GCCCTTGGGT AATTGGTCAT
AATCTACATC TTAAAACTAT CCATTTCCTC TAGATAAGAA AACATTGCCA AATCATGCGA ATGTTTAAAT ACAGCGGAAA
AATATTCAAC ATTTTTATTC CGGCAATATT TTTTCACCTG GCCATTCTCA GTTCGTTTTT GAACATGCGG TCTGTTTTTC
AGATAATATT TAAGCATGGT TCGTTGATAG TTAATTTTGG GAGATGTTCT CTTTTCATTC TTGGAACTAT TGAGCTTAGA
AATTGTTTGA TGCGAAGTGC TTCTGTCTAT ACAGTTGCGA AGCCATTGGT TGTTGATGGA ACATCTAAAT CCCACGAACT
ATCTCTTGCA TATGATGAGG CATCCTTATC AATGCTTGAT CCTCCTCTGG TCCTCCAGGA ATTTGTGAAC CATGGTAAGT
TCTGTTCCCC CCCTGTAACT GTAGTACTTT TGCATATCCT GAGACTTTTT CCTCCAACGG TAGAAGTTCG GACCTAAACT
ATTCCCTCTA CAGGTGGGAT CCTCTTTAAG GTGTACATCA TTGGTGAAAC TATACAAGTT GTACGGAGGT TTTCTCTTCC
TGATGTTAAC ACTTATGACT TATTAAACAA TGTTGGCGTC TATCGATTTC CAAGAGTTTC ATGTGCTGCA GCTAGTGCAG
ACCATGCAGA CCTCGATCCT CATATCTCAG GTGAGACATC TGCAGTATTG TAGTTAATCT TCATTTTGGT TATTATTGAT
CCATGCTTCA TTAATGTAAG AGGGGGCACT AAATTCAAAC ACAAACTTTC TTTAGAACCT TAACGCAGTG TACATGGTAA
AGAGTTTTTA TGTTTCCTTA CCATATATCA AGTCGAGGAC AGCGTTTGTT CTATGACATC GATACTTCTT GATTTATTTT
GCTTTTGATG AGTAGTCGAC GGCACCAGAT AAACTTTTGC TATATATTGA TCAGAACTTT CTGTTACATG ATAGAACTTC
CTCCAAGACC ACTCCTAGAG AAACTGGGAA AAGAGCTTCG TGGAAGACTG GTATGGCCAT GTATTTATAT TAACCAAGCT
CTGTTTCATA TGGTCGTCAT CTGACAGGCT TAAAAATTTC AGGGTTTAAG ATTGTTCAAC ATAGATATGA TCAGAGAACT
TGGAACCAAA GATCGGTACT ATATAATTGA CATCAACTAC TTCCCAGGTG TGCAGTTATT TTCCCACTGC CTTCATAAAT
GGCATACTAT CATTTGCGTT TCTTTTCTTC TCTTCATATG TTCGTGCAGA ATTTGTTAGG CCTGATTTTA TTCCAGCCTA
AGGGGAAAGG AGGATACATC GCTACACATA CCTGGACTTC TAGGCCAAAT TAATACTGAT CCAGTTTATC CAGTAGTACT
TTGTCGTCTC GAATTTCTGT GTTCTTGTTA TTTAACACAG CATGATCATT GTTCTGCAGC AGCATTTTCT TGAGTGTACG
CTCACTCCCT CTTGCTTGCG CAGGGTTCGG GAAAATGCCA GGTTATGAGC ACATATTCAC CGATTTCTTG CTGAATCTTG
CGCAAAGCAA GTACAAGAAG TGCTTAAGCG GCGGCTGAAG TGCAAAGAGT CCTGCTGAAC ATTAACAAAA TGGAATGTAA
CGGTCTAGCA GTCAGTGTAC ATATCTCGGA GAAATAAGTT TAATCCCAAG GCTTTGAGGA AGAGAGATTT AGGGTGTCTT
CCCAGAAAAT GGTGGCACTT ACCGGATTAG AGAAGAGATG AAAAAATGGA TCGATTTTCT AATGCCGAGT GCTTGTATAA
ATCACTAACA CTGAATGTTC CCAGCGTGCC TTCGTCAAGG CTTCTGTCTC AATAATTTCA TTATCTTTTT CATGAGCAAT
CCTTTTAGAA TG

Locus: Os03g0230500

Loading...

Locus: Os03g0230500

Loading...