Os03t0233300-01

Locus

Os03g0233300

Description

LysM receptor-like kinase, Arbuscular mycorrhizal (AM) symbiosis

RAP-DB Gene Symbol Synonym(s)

OsLysM-RLK2, OsLYK5, OsNFR5/OsRLK2

RAP-DB Gene Name Synonym(s)

LysM receptor-like kinase 2, LysM-type receptor-like kinase5

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLysM-RLK2, LysM-RLK2, OsLYK5, LYK5, OsNFR5, NFR5

Oryzabase Gene Name Synonym(s)

LysM receptor-like kinase 2, LysM-type receptor-like kinase5, Nod-Factor Receptor 5

Transcript Evidence

XM_015774288.1.

Protein Evidence

Q8S5X8

Literature

PMID: 27519312

Note

Manual Curation

September 30, 2016

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Protein kinase-like domain (IPR011009)

Protein kinase domain (IPR000719)

Serine-threonine/tyrosine-protein kinase catalytic domain (IPR001245)

Tyrosine-protein kinase, active site (IPR008266)

Expression Databases

TENOR (Os03t0233300-00)

Others

Oryzabase (10921)

KEGG (Os03t0233300-00 (EC:2.7.11.1))

Transcript

2590 bp

>Os03t0233300-01 LysM receptor-like kinase, Arbuscular mycorrhizal (AM) symbiosis
TGAAAAACCGAGCTCTCTCACTCCTCACAACTAGTACGTTCACAAGCACCGTGACAGCCA
GCTCCAAATGGAACACAAGGGTTTGTGCATCCTCGCCGTCGTCATCGCCTTCCAGCTCGC
CGGCGGGGAGGCCGTCACCGATGCCACTGCCCGGGCACGTCGCTTCGCCTGTAACGTGTC
GGCGCCGTGCGACACGTTCGTCGTGTACCGGACGCAGTCGCCGGGGTTCCTCGACCTCGG
CAACATCTCGGACCTGTTCGGCGTGAGCCGGGCGCTGATCGCCAGCGCCAACAAGCTGAC
CACCGAGGACGGGGTGCTCCTGCCGGGGCAGCCGCTGCTCGTGCCGGTCAAGTGCGGCTG
CACGGGCGCGCGCTCCTTCGCCAACGTCACGTACCCCATCCGGCCTCGCGACACCTTCTT
CGGGCTCGCCGTCACCGCGTTCGAGAACCTCACCGACTTCGTCCTCGTCGAGGAGCTCAA
CCCGGCGGCGGAGGCGACCAGGCTGGAGCCGTGGCAGGAGGTCGTCGTGCCGCTCTTCTG
CCGGTGCCCGACGCGGGAGGAGCTCAGCGCCGGGTCACGGCTCCTCGTCACCTACGTGTG
GCAGCCCGGGGACGACGTGTCCGTGGTGAGCGCGCTGATGAACGCCTCCGCTGCCAACAT
CGCCGCGTCGAACGGCGTCGCGGGCAACTCCACCTTCGCGACGGGGCAGCCCGTGCTGAT
CCCGGTGTCGCAGCCGCCGCGTTTTCCTCCGCTGACCTACGGTGCCATCGCCGCCGATCC
CGGAGCGGGCAAGCACCGCCACGGCATCATCGTGGCGACGAGCATCGCGGGGTCTTTCGT
CGCGTGCGCCGTGCTGTGCACGGCGATCTTGGCGTACCGGAGGTACCGCAAGAAGGCGCC
GGTGCCAAAGCACGTCAGCCCGAAGCTTTCTTGGACCAAGAGCCTGAACAGATTCGACAG
CAATAGCTCCATTGCTCGCATGATCAATGGAGGGGACAAGCTGCTCACCAGCGTGTCGCA
GTTCATCGACAAACCGATCATCTTTAGAGAGGAGGAAATCATGGAAGCGACGATGAACTT
GGACGAACAGTGCAAGCTCGGCAGCTCGTATTACCGCGCGAACCTTGAAAGGGAGGTGTT
CGCGGTGAAGCCGGCGAAAGGCAACGTTGCCGGGGAGCTGAGGATGATGCAGATGGTGAA
CCACGCCAACCTGACCAAGCTGGCCGGCATATCCATCGGCGCGGACGGCGACTACGCCTT
CCTCGTGTACGAGTTCGCCGAGAAGGGCTCGCTTGACAAGTGGCTGTACCAGAAGCCGCC
GTGCTCGCAGCCGTCGTCGAGCTCCGTGGCAACTCTGTCGTGGGACCAGAGGCTGGGCAT
CGCGCTGGACGTCGCGAACGGCTTGCTCTACCTGCACGAGCACACGCAGCCGAGCATGGT
GCACGGCGACGTCCGTGCCCGGAACATCCTCCTCACCGCGGGCTTCAGGGCGAAGCTGTC
CAACTTCTCCCTGGCCAAGCCGGCCGCCATGGTCGACGCGGCGGCGACGAGCAGCGACGT
GTTCGCGTTCGGGCTGCTCCTCCTCGAGCTCCTCTCCGGGAGGAGGGCGGTGGAGGCGCG
CGTCGGGGTGGAGATCGGCATGCTGCGGACGGAGATCCGCACCGTGCTGGACGCCGGCGG
GGACAAGAGGGCGGCGAAGCTGAGGAAGTGGATGGACCCGACCCTCGGCGGTGAGTACGG
CGTGGACGCGGCGCTCAGCTTGGCCGGCATGGCGAGGGCGTGCACCGAGGAGGACGCGGC
GCGGCGGCCCAAGATGGCCGAGATCGCGTTCAGCCTCTCGGTGCTCGGACAGCCGCTGTC
CGTCTCCGACGCGTTCGAGAGGCTATGGCAGCCCAGCTCGGAGGACAGCATCGGGATTGG
GAACGAGGTGGCAGCTAGATAGATCAAAACACAGCAATGGGTATGTATAACACTGTTGgg
tagtgtttggttgcaaggtttgggatggaatgcgatgggacgaacccacttttaaatagg
tttggtttaggggtgagcgggatgggttggtccctaaatagaataactcttaaatccggg
accaaccgatccggcaaaatcgagcggacgaactcgtcccacctgagatgggcgcacggc
atgagTCCCGTTGCTACTTTGCTCCTCGCATCAGTCACCTGGGGATGCTCGACGAGAGCA
CGTCgggctcgagcgacagcaggcggctcagtgacggcggcagtgaagtttggcggtagg
gagggcggcggcggtggatccgAAGGCCGGGGACTCGGCAGCGGCGGCAGATCCGGAGGC
AAAGCACGACTAGCCATAGCACGCAGAAATAAAGGAGACCCAATAAGGGGCTCAATCGCG
GACCAGTAAGACCCATGAACCAGCTAGACcaaaagacaatgcccttacatatatccctgt
cacgaggacaattatgtaaaatcattagcacaccaaaatttaaaggttgtaaacctataa
atagatctcaaataatgtgtaataggagatccaattttagagagaaactaatatactatt
tattattttc

CDS

1875 bp

>Os03t0233300-01 LysM receptor-like kinase, Arbuscular mycorrhizal (AM) symbiosis
ATGGAACACAAGGGTTTGTGCATCCTCGCCGTCGTCATCGCCTTCCAGCTCGCCGGCGGG
GAGGCCGTCACCGATGCCACTGCCCGGGCACGTCGCTTCGCCTGTAACGTGTCGGCGCCG
TGCGACACGTTCGTCGTGTACCGGACGCAGTCGCCGGGGTTCCTCGACCTCGGCAACATC
TCGGACCTGTTCGGCGTGAGCCGGGCGCTGATCGCCAGCGCCAACAAGCTGACCACCGAG
GACGGGGTGCTCCTGCCGGGGCAGCCGCTGCTCGTGCCGGTCAAGTGCGGCTGCACGGGC
GCGCGCTCCTTCGCCAACGTCACGTACCCCATCCGGCCTCGCGACACCTTCTTCGGGCTC
GCCGTCACCGCGTTCGAGAACCTCACCGACTTCGTCCTCGTCGAGGAGCTCAACCCGGCG
GCGGAGGCGACCAGGCTGGAGCCGTGGCAGGAGGTCGTCGTGCCGCTCTTCTGCCGGTGC
CCGACGCGGGAGGAGCTCAGCGCCGGGTCACGGCTCCTCGTCACCTACGTGTGGCAGCCC
GGGGACGACGTGTCCGTGGTGAGCGCGCTGATGAACGCCTCCGCTGCCAACATCGCCGCG
TCGAACGGCGTCGCGGGCAACTCCACCTTCGCGACGGGGCAGCCCGTGCTGATCCCGGTG
TCGCAGCCGCCGCGTTTTCCTCCGCTGACCTACGGTGCCATCGCCGCCGATCCCGGAGCG
GGCAAGCACCGCCACGGCATCATCGTGGCGACGAGCATCGCGGGGTCTTTCGTCGCGTGC
GCCGTGCTGTGCACGGCGATCTTGGCGTACCGGAGGTACCGCAAGAAGGCGCCGGTGCCA
AAGCACGTCAGCCCGAAGCTTTCTTGGACCAAGAGCCTGAACAGATTCGACAGCAATAGC
TCCATTGCTCGCATGATCAATGGAGGGGACAAGCTGCTCACCAGCGTGTCGCAGTTCATC
GACAAACCGATCATCTTTAGAGAGGAGGAAATCATGGAAGCGACGATGAACTTGGACGAA
CAGTGCAAGCTCGGCAGCTCGTATTACCGCGCGAACCTTGAAAGGGAGGTGTTCGCGGTG
AAGCCGGCGAAAGGCAACGTTGCCGGGGAGCTGAGGATGATGCAGATGGTGAACCACGCC
AACCTGACCAAGCTGGCCGGCATATCCATCGGCGCGGACGGCGACTACGCCTTCCTCGTG
TACGAGTTCGCCGAGAAGGGCTCGCTTGACAAGTGGCTGTACCAGAAGCCGCCGTGCTCG
CAGCCGTCGTCGAGCTCCGTGGCAACTCTGTCGTGGGACCAGAGGCTGGGCATCGCGCTG
GACGTCGCGAACGGCTTGCTCTACCTGCACGAGCACACGCAGCCGAGCATGGTGCACGGC
GACGTCCGTGCCCGGAACATCCTCCTCACCGCGGGCTTCAGGGCGAAGCTGTCCAACTTC
TCCCTGGCCAAGCCGGCCGCCATGGTCGACGCGGCGGCGACGAGCAGCGACGTGTTCGCG
TTCGGGCTGCTCCTCCTCGAGCTCCTCTCCGGGAGGAGGGCGGTGGAGGCGCGCGTCGGG
GTGGAGATCGGCATGCTGCGGACGGAGATCCGCACCGTGCTGGACGCCGGCGGGGACAAG
AGGGCGGCGAAGCTGAGGAAGTGGATGGACCCGACCCTCGGCGGTGAGTACGGCGTGGAC
GCGGCGCTCAGCTTGGCCGGCATGGCGAGGGCGTGCACCGAGGAGGACGCGGCGCGGCGG
CCCAAGATGGCCGAGATCGCGTTCAGCCTCTCGGTGCTCGGACAGCCGCTGTCCGTCTCC
GACGCGTTCGAGAGGCTATGGCAGCCCAGCTCGGAGGACAGCATCGGGATTGGGAACGAG
GTGGCAGCTAGATAG

Protein

625 aa

>Os03t0233300-01 LysM receptor-like kinase, Arbuscular mycorrhizal (AM) symbiosis
MEHKGLCILAVVIAFQLAGGEAVTDATARARRFACNVSAPCDTFVVYRTQSPGFLDLGNI
SDLFGVSRALIASANKLTTEDGVLLPGQPLLVPVKCGCTGARSFANVTYPIRPRDTFFGL
AVTAFENLTDFVLVEELNPAAEATRLEPWQEVVVPLFCRCPTREELSAGSRLLVTYVWQP
GDDVSVVSALMNASAANIAASNGVAGNSTFATGQPVLIPVSQPPRFPPLTYGAIAADPGA
GKHRHGIIVATSIAGSFVACAVLCTAILAYRRYRKKAPVPKHVSPKLSWTKSLNRFDSNS
SIARMINGGDKLLTSVSQFIDKPIIFREEEIMEATMNLDEQCKLGSSYYRANLEREVFAV
KPAKGNVAGELRMMQMVNHANLTKLAGISIGADGDYAFLVYEFAEKGSLDKWLYQKPPCS
QPSSSSVATLSWDQRLGIALDVANGLLYLHEHTQPSMVHGDVRARNILLTAGFRAKLSNF
SLAKPAAMVDAAATSSDVFAFGLLLLELLSGRRAVEARVGVEIGMLRTEIRTVLDAGGDK
RAAKLRKWMDPTLGGEYGVDAALSLAGMARACTEEDAARRPKMAEIAFSLSVLGQPLSVS
DAFERLWQPSSEDSIGIGNEVAAR*

5'UTR

chr03:7070508..7070574 (- strand) : 67 bp

CDS

chr03:7068633..7070507 (- strand) : 1875 bp

3'UTR

chr03:7067985..7068632 (- strand) : 648 bp

FASTA

>Os03t0233300-01 class=Sequence position=chr03:7067985..7070574 (- strand)
TGAAAAACCG AGCTCTCTCA CTCCTCACAA CTAGTACGTT CACAAGCACC GTGACAGCCA GCTCCAAATG GAACACAAGG
GTTTGTGCAT CCTCGCCGTC GTCATCGCCT TCCAGCTCGC CGGCGGGGAG GCCGTCACCG ATGCCACTGC CCGGGCACGT
CGCTTCGCCT GTAACGTGTC GGCGCCGTGC GACACGTTCG TCGTGTACCG GACGCAGTCG CCGGGGTTCC TCGACCTCGG
CAACATCTCG GACCTGTTCG GCGTGAGCCG GGCGCTGATC GCCAGCGCCA ACAAGCTGAC CACCGAGGAC GGGGTGCTCC
TGCCGGGGCA GCCGCTGCTC GTGCCGGTCA AGTGCGGCTG CACGGGCGCG CGCTCCTTCG CCAACGTCAC GTACCCCATC
CGGCCTCGCG ACACCTTCTT CGGGCTCGCC GTCACCGCGT TCGAGAACCT CACCGACTTC GTCCTCGTCG AGGAGCTCAA
CCCGGCGGCG GAGGCGACCA GGCTGGAGCC GTGGCAGGAG GTCGTCGTGC CGCTCTTCTG CCGGTGCCCG ACGCGGGAGG
AGCTCAGCGC CGGGTCACGG CTCCTCGTCA CCTACGTGTG GCAGCCCGGG GACGACGTGT CCGTGGTGAG CGCGCTGATG
AACGCCTCCG CTGCCAACAT CGCCGCGTCG AACGGCGTCG CGGGCAACTC CACCTTCGCG ACGGGGCAGC CCGTGCTGAT
CCCGGTGTCG CAGCCGCCGC GTTTTCCTCC GCTGACCTAC GGTGCCATCG CCGCCGATCC CGGAGCGGGC AAGCACCGCC
ACGGCATCAT CGTGGCGACG AGCATCGCGG GGTCTTTCGT CGCGTGCGCC GTGCTGTGCA CGGCGATCTT GGCGTACCGG
AGGTACCGCA AGAAGGCGCC GGTGCCAAAG CACGTCAGCC CGAAGCTTTC TTGGACCAAG AGCCTGAACA GATTCGACAG
CAATAGCTCC ATTGCTCGCA TGATCAATGG AGGGGACAAG CTGCTCACCA GCGTGTCGCA GTTCATCGAC AAACCGATCA
TCTTTAGAGA GGAGGAAATC ATGGAAGCGA CGATGAACTT GGACGAACAG TGCAAGCTCG GCAGCTCGTA TTACCGCGCG
AACCTTGAAA GGGAGGTGTT CGCGGTGAAG CCGGCGAAAG GCAACGTTGC CGGGGAGCTG AGGATGATGC AGATGGTGAA
CCACGCCAAC CTGACCAAGC TGGCCGGCAT ATCCATCGGC GCGGACGGCG ACTACGCCTT CCTCGTGTAC GAGTTCGCCG
AGAAGGGCTC GCTTGACAAG TGGCTGTACC AGAAGCCGCC GTGCTCGCAG CCGTCGTCGA GCTCCGTGGC AACTCTGTCG
TGGGACCAGA GGCTGGGCAT CGCGCTGGAC GTCGCGAACG GCTTGCTCTA CCTGCACGAG CACACGCAGC CGAGCATGGT
GCACGGCGAC GTCCGTGCCC GGAACATCCT CCTCACCGCG GGCTTCAGGG CGAAGCTGTC CAACTTCTCC CTGGCCAAGC
CGGCCGCCAT GGTCGACGCG GCGGCGACGA GCAGCGACGT GTTCGCGTTC GGGCTGCTCC TCCTCGAGCT CCTCTCCGGG
AGGAGGGCGG TGGAGGCGCG CGTCGGGGTG GAGATCGGCA TGCTGCGGAC GGAGATCCGC ACCGTGCTGG ACGCCGGCGG
GGACAAGAGG GCGGCGAAGC TGAGGAAGTG GATGGACCCG ACCCTCGGCG GTGAGTACGG CGTGGACGCG GCGCTCAGCT
TGGCCGGCAT GGCGAGGGCG TGCACCGAGG AGGACGCGGC GCGGCGGCCC AAGATGGCCG AGATCGCGTT CAGCCTCTCG
GTGCTCGGAC AGCCGCTGTC CGTCTCCGAC GCGTTCGAGA GGCTATGGCA GCCCAGCTCG GAGGACAGCA TCGGGATTGG
GAACGAGGTG GCAGCTAGAT AGATCAAAAC ACAGCAATGG GTATGTATAA CACTGTTGgg tagtgtttgg ttgcaaggtt
tgggatggaa tgcgatggga cgaacccact tttaaatagg tttggtttag gggtgagcgg gatgggttgg tccctaaata
gaataactct taaatccggg accaaccgat ccggcaaaat cgagcggacg aactcgtccc acctgagatg ggcgcacggc
atgagTCCCG TTGCTACTTT GCTCCTCGCA TCAGTCACCT GGGGATGCTC GACGAGAGCA CGTCgggctc gagcgacagc
aggcggctca gtgacggcgg cagtgaagtt tggcggtagg gagggcggcg gcggtggatc cgAAGGCCGG GGACTCGGCA
GCGGCGGCAG ATCCGGAGGC AAAGCACGAC TAGCCATAGC ACGCAGAAAT AAAGGAGACC CAATAAGGGG CTCAATCGCG
GACCAGTAAG ACCCATGAAC CAGCTAGACc aaaagacaat gcccttacat atatccctgt cacgaggaca attatgtaaa
atcattagca caccaaaatt taaaggttgt aaacctataa atagatctca aataatgtgt aataggagat ccaattttag
agagaaacta atatactatt tattattttc 

Locus: Os03g0233300

Loading...

Locus: Os03g0233300

Loading...