Os03t0238600-01

Locus

Os03g0238600

Description

Similar to Purple acid phosphatase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PAP3C

CGSNL Gene Name

PURPLE ACID PHOSPHATASE 3C

Oryzabase Gene Symbol Synonym(s)

OsPAP3c

Oryzabase Gene Name Synonym(s)

purple acid phosphatase 3c

Transcript Evidence

AK070684 (DDBJ, Best hit)

AK104621 (DDBJ, Best hit)

AK104751 (DDBJ, Best hit)

AK119619 (DDBJ, Best hit)

Protein Evidence

D3KVP3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: hydrolase activity (GO:0016787)

Functional domain (InterPro)

Metallophosphoesterase domain (IPR004843)

Full-length cDNA

J023062L13 (Online Clone Ordering)

006-309-G08 (Online Clone Ordering)

001-038-F06 (Online Clone Ordering)

002-117-H01 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0238600-01)

Others

Oryzabase (11378)

Transcript

1398 bp

>Os03t0238600-01 Similar to Purple acid phosphatase.
GGAGCCTCTCGTTACCGAGAGAGAGAGAGAGAGAGAGAGAGAGGGCAGTGCAGGTGTCGC
TGGCCATGGCGAGGAGGAGCAGCAGCAGAGCGTGCGCGGCCATGGCGACGGCCGCCGTCT
TTGCGCTGCTGGCCGCGACGGCGACGGCGTCGGGGCTCGTACGGGTGGAGCACCCGGCCA
AGAGCGACGGGTCGCTGAGCCTGCTCGTCGTCGGCGACTGGGGCCGGAAGGGCACGTACA
ACCAATCCAGGGTCGCCGAGCAGATGGGGAAGGTTGGGGAGAAGCTAAATATAGACTTCG
TCATATCCACCGGTGACAATTTCTACGAGGATGGACTCACTGGCGTCGATGACCAGGCGT
TTGAGGAATCGTTTACCGATATCTACACGGCAAAGAGCTTGCAGAAGCCATGGTACCTGG
TGCTGGGAAATCATGACTACAGGGGTGATGTGCTAGCACAGCTTAGCCCAGTCTTGCGAA
AGATCGACCAGCGATTCATTTGCATGAGGTCGTTCATTGTTAATGCAGAGATTGTGGATT
TCTTCTTTATCGACACAACTCCATTTCAGCTGAAATATTGGACTCGCCCTAAAGACCATC
ATTATGACTGGAGAGGAGTGGCACCTCGACAAAAATACATAACTAATCTACTTAAGGATA
TGGATGAGGCAATGAAGAAATCAACAGCGAAGTGGAAGATTGCTGTTGGGCATCATACCA
TTAGGAGCGTCAGTGACCATGGTGACACCAAGGAGCTTCTGCAACTTCTACTTCCAGTTC
TGAAGGTCAATGGCATCGACTTCTACATCAATGGGCACGACCACTGCCTGGAACACATTA
GCAGCAGAGACAGTCCTATCCAATACTTCACAAGTGGAGGTGGTTCAAAAGCATGGAGAG
GAGTCTTGCAGCCAAATTCTGATAAGCTCCAGTTCTTTTACGATGGACAAGGGTTCATGT
CCCTCCAGATAAACCAGGACCAAGCTGACTTCATATTTTATGATGTTTCTGGGAACATCT
TGTACAAGTGGAGCAAGAGCAAAGCAAACTACCTCCAGCCCTCCACCTATATCACTGAAG
CATGAGGCAGATGCAAAACCACAAAACGGAGAATTAGCTTGGCTAAGATATTTGTATCAA
ATTTGAATGCATTATTGTGGCACGCAAGGGAAGAGGACCGGAAAGGAAATAGGAAAGTAT
TTAAGCATGGCATGTGATTGATCTACTAAAGAAATTTGAGACAAGGCCGAGACCATCCTA
CTAGACTAGGAAAAGAGATGTTCAGTATGGTATCCATTAGATCTGATTCATACAACTTCT
TGCCAGAGGACCATCGATTATGCCATGTATAATTTACAAAGAAGGCTTAAAACTCTAAAA
GCTAGTAGTGACCTTTGC

CDS

1020 bp

>Os03t0238600-01 Similar to Purple acid phosphatase.
ATGGCGAGGAGGAGCAGCAGCAGAGCGTGCGCGGCCATGGCGACGGCCGCCGTCTTTGCG
CTGCTGGCCGCGACGGCGACGGCGTCGGGGCTCGTACGGGTGGAGCACCCGGCCAAGAGC
GACGGGTCGCTGAGCCTGCTCGTCGTCGGCGACTGGGGCCGGAAGGGCACGTACAACCAA
TCCAGGGTCGCCGAGCAGATGGGGAAGGTTGGGGAGAAGCTAAATATAGACTTCGTCATA
TCCACCGGTGACAATTTCTACGAGGATGGACTCACTGGCGTCGATGACCAGGCGTTTGAG
GAATCGTTTACCGATATCTACACGGCAAAGAGCTTGCAGAAGCCATGGTACCTGGTGCTG
GGAAATCATGACTACAGGGGTGATGTGCTAGCACAGCTTAGCCCAGTCTTGCGAAAGATC
GACCAGCGATTCATTTGCATGAGGTCGTTCATTGTTAATGCAGAGATTGTGGATTTCTTC
TTTATCGACACAACTCCATTTCAGCTGAAATATTGGACTCGCCCTAAAGACCATCATTAT
GACTGGAGAGGAGTGGCACCTCGACAAAAATACATAACTAATCTACTTAAGGATATGGAT
GAGGCAATGAAGAAATCAACAGCGAAGTGGAAGATTGCTGTTGGGCATCATACCATTAGG
AGCGTCAGTGACCATGGTGACACCAAGGAGCTTCTGCAACTTCTACTTCCAGTTCTGAAG
GTCAATGGCATCGACTTCTACATCAATGGGCACGACCACTGCCTGGAACACATTAGCAGC
AGAGACAGTCCTATCCAATACTTCACAAGTGGAGGTGGTTCAAAAGCATGGAGAGGAGTC
TTGCAGCCAAATTCTGATAAGCTCCAGTTCTTTTACGATGGACAAGGGTTCATGTCCCTC
CAGATAAACCAGGACCAAGCTGACTTCATATTTTATGATGTTTCTGGGAACATCTTGTAC
AAGTGGAGCAAGAGCAAAGCAAACTACCTCCAGCCCTCCACCTATATCACTGAAGCATGA

Protein

340 aa

>Os03t0238600-01 Similar to Purple acid phosphatase.
MARRSSSRACAAMATAAVFALLAATATASGLVRVEHPAKSDGSLSLLVVGDWGRKGTYNQ
SRVAEQMGKVGEKLNIDFVISTGDNFYEDGLTGVDDQAFEESFTDIYTAKSLQKPWYLVL
GNHDYRGDVLAQLSPVLRKIDQRFICMRSFIVNAEIVDFFFIDTTPFQLKYWTRPKDHHY
DWRGVAPRQKYITNLLKDMDEAMKKSTAKWKIAVGHHTIRSVSDHGDTKELLQLLLPVLK
VNGIDFYINGHDHCLEHISSRDSPIQYFTSGGGSKAWRGVLQPNSDKLQFFYDGQGFMSL
QINQDQADFIFYDVSGNILYKWSKSKANYLQPSTYITEA*

5'UTR

chr03:7322529..7322593 (+ strand) : 65 bp

CDS

chr03:7322594..7322791 (+ strand) : 198 bp

chr03:7323506..7323662 (+ strand) : 157 bp

chr03:7323778..7323885 (+ strand) : 108 bp

chr03:7324002..7324129 (+ strand) : 128 bp

chr03:7324241..7324369 (+ strand) : 129 bp

chr03:7324453..7324520 (+ strand) : 68 bp

chr03:7324638..7324869 (+ strand) : 232 bp

3'UTR

chr03:7324870..7325182 (+ strand) : 313 bp

FASTA

>Os03t0238600-01 class=Sequence position=chr03:7322529..7325182 (+ strand)
GGAGCCTCTC GTTACCGAGA GAGAGAGAGA GAGAGAGAGA GAGGGCAGTG CAGGTGTCGC TGGCCATGGC GAGGAGGAGC
AGCAGCAGAG CGTGCGCGGC CATGGCGACG GCCGCCGTCT TTGCGCTGCT GGCCGCGACG GCGACGGCGT CGGGGCTCGT
ACGGGTGGAG CACCCGGCCA AGAGCGACGG GTCGCTGAGC CTGCTCGTCG TCGGCGACTG GGGCCGGAAG GGCACGTACA
ACCAATCCAG GGTCGCCGAG CAGGTAAAAC CAAACGCCCC CTCCTCCTCC GTCGGCCGCG ATCCGTTTCC TCGCTTCCCG
GGATTTAACT CTAGTTGTTA AATTTTGCTC TAATTGCTGC GGTAAATCCA TGGTTTGAGC TGGCCGTTTT AAGGTCCTAA
CCGCGCATTA CGGGCTCGGA TAATTGGATT GGATGGAAAA GAGAGAGAGA GAGTGAGGAG ACGGCGAGAT GGGGGGGAGG
GAGTCCAGAT GGGATTCGGT TTGGCAGTTG ATGGCGTGTG CGTACAGTGC TGGGTTGGTT GGTTGGTTGC TTGCTTGCTT
CGCCAGTTGG CATTTCGTCG CGTATGGTTT AAACTGACGA AGTCGCCGGT GACGACGCCG CGATGGCGTG GGCTTCTTTT
GGTCTTCTGC CCGCCGGTAT GGGCGCGCGG CCGAATGAAG GAATGGGAGG GGAGAATATC AGAGTAGAAC TGCCAATACG
CAGATGCCCA TATTACCGAA CTGGCCGATG TGATCAGAAA CTATTCTCTT GTTGTGTGCT CGAGCAATTA ACAGTTTACC
TCCAGTGAAA TGGCTACCTT CATTTCTGGG ATTAGCAGCG GACAGTTTTC AGAAGACATC TCTTGACCAT TATTTTCTAT
TTGTATTATT AAAGTGAATA CTTTTTTTAA AACTGAAGGT ATTATTTTTT AAATAGCAAA GACAAACAAT ATTAAGTATG
GACAATTTAT CATGCAGATG GGGAAGGTTG GGGAGAAGCT AAATATAGAC TTCGTCATAT CCACCGGTGA CAATTTCTAC
GAGGATGGAC TCACTGGCGT CGATGACCAG GCGTTTGAGG AATCGTTTAC CGATATCTAC ACGGCAAAGA GCTTGCAGAA
GCCATGGTAC CTGGGTAAGC TTTCTGCTTC TTGTCACTTA TGTCACCAAT AACATTTACC AAGTACCCCT GTTACGAAAT
ATGCTAATAT GTTATTTGAA CGTGTACTAA AACATGAACA TTTCTTCAGT GCTGGGAAAT CATGACTACA GGGGTGATGT
GCTAGCACAG CTTAGCCCAG TCTTGCGAAA GATCGACCAG CGATTCATTT GCATGAGGTC GTTCATTGTT AATGCAGGTA
GGAAAAAAAA TGCAGTATTT GGTTACTACT TGGATATGAT GATAGAGTTC TGAACTGTAA CGTGCAAAAC AACGCTAACT
TTGTATGATC TGTCATCAAC CTTTTTTTTT CAGAGATTGT GGATTTCTTC TTTATCGACA CAACTCCATT TCAGCTGAAA
TATTGGACTC GCCCTAAAGA CCATCATTAT GACTGGAGAG GAGTGGCACC TCGACAAAAA TACATAACTA ATCTACTTAA
GGTGCGCATT TGGAATGGAA CAGTCATCAA TGCTTAAGAA CAAAAAAAAG CTATTCCTAG GTTGCTGAGC AAAATTGTTT
TAATATTTTA TTTTATGGGG TCTACTATCT AGGATATGGA TGAGGCAATG AAGAAATCAA CAGCGAAGTG GAAGATTGCT
GTTGGGCATC ATACCATTAG GAGCGTCAGT GACCATGGTG ACACCAAGGA GCTTCTGCAA CTTCTACTTC CAGTTCTGAA
GGTTATACAG AAGTTGCCTC GATATTAAGT TCTGAAGGAT CCACAAAAAG AGTACTTCCT TATCACTGTT TCATGGAATT
TCAGGTCAAT GGCATCGACT TCTACATCAA TGGGCACGAC CACTGCCTGG AACACATTAG CAGCAGAGAC AGGTTAACAT
CATTTGACAC AAAGTTTCCG CTTTTATGTC ACAGTAATAT AGAACAAAAC ATGTTTGCAT AATCGATGAA ACTTGTCTAA
CCTGAATGCA TGCACTCCTA TTGTTACAGT CCTATCCAAT ACTTCACAAG TGGAGGTGGT TCAAAAGCAT GGAGAGGAGT
CTTGCAGCCA AATTCTGATA AGCTCCAGTT CTTTTACGAT GGACAAGGGT TCATGTCCCT CCAGATAAAC CAGGACCAAG
CTGACTTCAT ATTTTATGAT GTTTCTGGGA ACATCTTGTA CAAGTGGAGC AAGAGCAAAG CAAACTACCT CCAGCCCTCC
ACCTATATCA CTGAAGCATG AGGCAGATGC AAAACCACAA AACGGAGAAT TAGCTTGGCT AAGATATTTG TATCAAATTT
GAATGCATTA TTGTGGCACG CAAGGGAAGA GGACCGGAAA GGAAATAGGA AAGTATTTAA GCATGGCATG TGATTGATCT
ACTAAAGAAA TTTGAGACAA GGCCGAGACC ATCCTACTAG ACTAGGAAAA GAGATGTTCA GTATGGTATC CATTAGATCT
GATTCATACA ACTTCTTGCC AGAGGACCAT CGATTATGCC ATGTATAATT TACAAAGAAG GCTTAAAACT CTAAAAGCTA
GTAGTGACCT TTGC

Locus: Os03g0238600

Loading...

Locus: Os03g0238600

Loading...