Os03t0240600-01

Locus

Os03g0240600

Description

U-box containing E3 ligase, Response to phosphate starvation

RAP-DB Gene Symbol Synonym(s)

OsUPS

RAP-DB Gene Name Synonym(s)

U-box containing E3 ligase induced by phosphate starvation

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsUPS, OsPUB41

Oryzabase Gene Name Synonym(s)

U-box containing E3 ligase induced by phosphate starvation, plant U-box-containing protein 41, U-box protein 41

Transcript Evidence

AK109161

JN162673 (Dongjin)

Protein Evidence

Q10PB1

Literature

PMID: 22201023

Note

Manual Curation

April 25, 2017

Gene Ontology (GO)

Biological Process: protein ubiquitination (GO:0016567)

Molecular Function: ubiquitin-protein transferase activity (GO:0004842)

Molecular Function: binding (GO:0005488)

Functional domain (InterPro)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

U box domain (IPR003613)

Armadillo-type fold (IPR016024)

Armadillo-like helical (IPR011989)

Full-length cDNA

002-155-G08 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0240600-01)

RiceXPro (AK109161)

Others

Oryzabase (10220)

KEGG (Os03t0240600-01)

Transcript

1606 bp

>Os03t0240600-01 U-box containing E3 ligase, Response to phosphate starvation
GTATTGAACTCTTCTCAGCTCAAAGCCTTACACCACAACACGCAGCTGTTCTCGCTGGGC
TTCTCTTCTTGCGCTGCGGTGATCGATCGAGAGCTTGGGATGGCGCTGCTGGCGCGGAGG
GCGCGGAAGGCGGTGATGGCGAAGGCGCCGGCGCCGCTGCTGCAGAAGAGGGGTGGCGGC
GCGGCGGCGGAGCTGGCGATCCCGGCGCACTTCCGGTGCCCGATCTCGCTGGACCTGATG
CGCGACCCGGTGACGGCGCCGACGGGGATCACGTACGACAGGGAGGGGATCGAGGCGTGG
CTGGACACCGGGCGCGCGGTGTGCCCCGTCACCCACGCGCCGCTCCGGCACGAGGACCTC
GTCCCCAACCACGCCATCCGCCGCGTCATCCAGGACTGGTGCGTCGCCAACCGGTCCCGC
GGCGTGGAGCGCATCCCCACGCCCAAGATCCCCGTCACGCCCGTGCAGGCCTCCGAGCTG
CTGTTCGACGTCGCGGAGTCGGCGGCGCGGCGCGGCGCGGCGGGGCGCGCCGCCGGGGCG
GTCGCCAGGGTCCGGGCGCTCGCGAGGGACAGCGAGCGGAACCGGCGGTGCTTCGTGTCC
GTCGGCACGGGGCGCGTGCTGGCCGCGGCGTTCGAGTCTCTCGCCGCCGCCGGGGAGGCG
GGCGTTCTCGAGGACGTCCTGGCGGCATTGGTCTGCATGATGCCGTTGGACGAGGAGGCG
GCCAGGGTCTTGGCCTCGTCTAGCTCGATGGGTTCACTCGTCGCCATTGCCAAGCACGGG
AGCTTGGCCGGAAGGCTGAACGCTGTGCTGGCGATCAAGGAGGCCGTGTCGCGGGACGGA
GCGTTCGTGGACCTGGCGGATGACAAGGTCGACAAGGTCGTCGACGCGCTGGTCGTGATC
ATCAAGGCTCCGATCTGCCCGCAGGCCACCAAGGCTGCCATGGTCGCCACCTACCACCTG
GCGAGCTCCGACGAGCGCGTCGCGGCGAGGGTAGCATCCACGGGGCTCGTCCCAACGCTC
ATCGAGGCCCTCGTAGACGCCGACAAGAGCGTGTCCGAGAAGGCCCTGGCGGTGCTCGAC
GCAATGCTCGCCTCGGAGGAAGGCCGCGCGAGCGCGCGGGGCCACGCCCTCGCAATGCCG
GCCCTCGTGAAGAAGATGTTCCGCGTGTCCGACGTGGCCACCGAGCTCGCCGTGTCGGCG
ATGTGGCGGCTCGGCTGCAAGGCCTCCTCCGGCGACGAGGAGGCCGCCGCGACGGGGTGC
CTGGTCGAGGCGCTGCGTGTGGGCGCGTTCCAGAAGCTTCTCCTCCTCCTGCAGGTGGGC
TGCAGGGACGCGACCAAGGAGAAGGCCACTGAGCTGCTCAAGATGCTCAACAAGCACAAA
GGGTTGGGGGAGTGTGTCGACGCTGTGGATTTCAGAGGGCTCAATAGGCTGTCATGAATT
GAGATCAGTGTTCAGAATCATTGTAAAAATAGTTGCGAGCAGCTAGGAAATGCAGATTGT
AAAAATAGTTGATGGGGATTTTTGCGGATGTGCTTTCCATGCTAGATTGTAAATCTAATT
GCAAAAACAAGTTTCCTACTTTCCTCACTGTAAATATTTTGCATGT

CDS

1338 bp

>Os03t0240600-01 U-box containing E3 ligase, Response to phosphate starvation
ATGGCGCTGCTGGCGCGGAGGGCGCGGAAGGCGGTGATGGCGAAGGCGCCGGCGCCGCTG
CTGCAGAAGAGGGGTGGCGGCGCGGCGGCGGAGCTGGCGATCCCGGCGCACTTCCGGTGC
CCGATCTCGCTGGACCTGATGCGCGACCCGGTGACGGCGCCGACGGGGATCACGTACGAC
AGGGAGGGGATCGAGGCGTGGCTGGACACCGGGCGCGCGGTGTGCCCCGTCACCCACGCG
CCGCTCCGGCACGAGGACCTCGTCCCCAACCACGCCATCCGCCGCGTCATCCAGGACTGG
TGCGTCGCCAACCGGTCCCGCGGCGTGGAGCGCATCCCCACGCCCAAGATCCCCGTCACG
CCCGTGCAGGCCTCCGAGCTGCTGTTCGACGTCGCGGAGTCGGCGGCGCGGCGCGGCGCG
GCGGGGCGCGCCGCCGGGGCGGTCGCCAGGGTCCGGGCGCTCGCGAGGGACAGCGAGCGG
AACCGGCGGTGCTTCGTGTCCGTCGGCACGGGGCGCGTGCTGGCCGCGGCGTTCGAGTCT
CTCGCCGCCGCCGGGGAGGCGGGCGTTCTCGAGGACGTCCTGGCGGCATTGGTCTGCATG
ATGCCGTTGGACGAGGAGGCGGCCAGGGTCTTGGCCTCGTCTAGCTCGATGGGTTCACTC
GTCGCCATTGCCAAGCACGGGAGCTTGGCCGGAAGGCTGAACGCTGTGCTGGCGATCAAG
GAGGCCGTGTCGCGGGACGGAGCGTTCGTGGACCTGGCGGATGACAAGGTCGACAAGGTC
GTCGACGCGCTGGTCGTGATCATCAAGGCTCCGATCTGCCCGCAGGCCACCAAGGCTGCC
ATGGTCGCCACCTACCACCTGGCGAGCTCCGACGAGCGCGTCGCGGCGAGGGTAGCATCC
ACGGGGCTCGTCCCAACGCTCATCGAGGCCCTCGTAGACGCCGACAAGAGCGTGTCCGAG
AAGGCCCTGGCGGTGCTCGACGCAATGCTCGCCTCGGAGGAAGGCCGCGCGAGCGCGCGG
GGCCACGCCCTCGCAATGCCGGCCCTCGTGAAGAAGATGTTCCGCGTGTCCGACGTGGCC
ACCGAGCTCGCCGTGTCGGCGATGTGGCGGCTCGGCTGCAAGGCCTCCTCCGGCGACGAG
GAGGCCGCCGCGACGGGGTGCCTGGTCGAGGCGCTGCGTGTGGGCGCGTTCCAGAAGCTT
CTCCTCCTCCTGCAGGTGGGCTGCAGGGACGCGACCAAGGAGAAGGCCACTGAGCTGCTC
AAGATGCTCAACAAGCACAAAGGGTTGGGGGAGTGTGTCGACGCTGTGGATTTCAGAGGG
CTCAATAGGCTGTCATGA

Protein

446 aa

>Os03t0240600-01 U-box containing E3 ligase, Response to phosphate starvation
MALLARRARKAVMAKAPAPLLQKRGGGAAAELAIPAHFRCPISLDLMRDPVTAPTGITYD
REGIEAWLDTGRAVCPVTHAPLRHEDLVPNHAIRRVIQDWCVANRSRGVERIPTPKIPVT
PVQASELLFDVAESAARRGAAGRAAGAVARVRALARDSERNRRCFVSVGTGRVLAAAFES
LAAAGEAGVLEDVLAALVCMMPLDEEAARVLASSSSMGSLVAIAKHGSLAGRLNAVLAIK
EAVSRDGAFVDLADDKVDKVVDALVVIIKAPICPQATKAAMVATYHLASSDERVAARVAS
TGLVPTLIEALVDADKSVSEKALAVLDAMLASEEGRASARGHALAMPALVKKMFRVSDVA
TELAVSAMWRLGCKASSGDEEAAATGCLVEALRVGAFQKLLLLLQVGCRDATKEKATELL
KMLNKHKGLGECVDAVDFRGLNRLS*

5'UTR

chr03:7441909..7442007 (- strand) : 99 bp

CDS

chr03:7440571..7441908 (- strand) : 1338 bp

3'UTR

chr03:7440402..7440570 (- strand) : 169 bp

FASTA

>Os03t0240600-01 class=Sequence position=chr03:7440402..7442007 (- strand)
GTATTGAACT CTTCTCAGCT CAAAGCCTTA CACCACAACA CGCAGCTGTT CTCGCTGGGC TTCTCTTCTT GCGCTGCGGT
GATCGATCGA GAGCTTGGGA TGGCGCTGCT GGCGCGGAGG GCGCGGAAGG CGGTGATGGC GAAGGCGCCG GCGCCGCTGC
TGCAGAAGAG GGGTGGCGGC GCGGCGGCGG AGCTGGCGAT CCCGGCGCAC TTCCGGTGCC CGATCTCGCT GGACCTGATG
CGCGACCCGG TGACGGCGCC GACGGGGATC ACGTACGACA GGGAGGGGAT CGAGGCGTGG CTGGACACCG GGCGCGCGGT
GTGCCCCGTC ACCCACGCGC CGCTCCGGCA CGAGGACCTC GTCCCCAACC ACGCCATCCG CCGCGTCATC CAGGACTGGT
GCGTCGCCAA CCGGTCCCGC GGCGTGGAGC GCATCCCCAC GCCCAAGATC CCCGTCACGC CCGTGCAGGC CTCCGAGCTG
CTGTTCGACG TCGCGGAGTC GGCGGCGCGG CGCGGCGCGG CGGGGCGCGC CGCCGGGGCG GTCGCCAGGG TCCGGGCGCT
CGCGAGGGAC AGCGAGCGGA ACCGGCGGTG CTTCGTGTCC GTCGGCACGG GGCGCGTGCT GGCCGCGGCG TTCGAGTCTC
TCGCCGCCGC CGGGGAGGCG GGCGTTCTCG AGGACGTCCT GGCGGCATTG GTCTGCATGA TGCCGTTGGA CGAGGAGGCG
GCCAGGGTCT TGGCCTCGTC TAGCTCGATG GGTTCACTCG TCGCCATTGC CAAGCACGGG AGCTTGGCCG GAAGGCTGAA
CGCTGTGCTG GCGATCAAGG AGGCCGTGTC GCGGGACGGA GCGTTCGTGG ACCTGGCGGA TGACAAGGTC GACAAGGTCG
TCGACGCGCT GGTCGTGATC ATCAAGGCTC CGATCTGCCC GCAGGCCACC AAGGCTGCCA TGGTCGCCAC CTACCACCTG
GCGAGCTCCG ACGAGCGCGT CGCGGCGAGG GTAGCATCCA CGGGGCTCGT CCCAACGCTC ATCGAGGCCC TCGTAGACGC
CGACAAGAGC GTGTCCGAGA AGGCCCTGGC GGTGCTCGAC GCAATGCTCG CCTCGGAGGA AGGCCGCGCG AGCGCGCGGG
GCCACGCCCT CGCAATGCCG GCCCTCGTGA AGAAGATGTT CCGCGTGTCC GACGTGGCCA CCGAGCTCGC CGTGTCGGCG
ATGTGGCGGC TCGGCTGCAA GGCCTCCTCC GGCGACGAGG AGGCCGCCGC GACGGGGTGC CTGGTCGAGG CGCTGCGTGT
GGGCGCGTTC CAGAAGCTTC TCCTCCTCCT GCAGGTGGGC TGCAGGGACG CGACCAAGGA GAAGGCCACT GAGCTGCTCA
AGATGCTCAA CAAGCACAAA GGGTTGGGGG AGTGTGTCGA CGCTGTGGAT TTCAGAGGGC TCAATAGGCT GTCATGAATT
GAGATCAGTG TTCAGAATCA TTGTAAAAAT AGTTGCGAGC AGCTAGGAAA TGCAGATTGT AAAAATAGTT GATGGGGATT
TTTGCGGATG TGCTTTCCAT GCTAGATTGT AAATCTAATT GCAAAAACAA GTTTCCTACT TTCCTCACTG TAAATATTTT
GCATGT