Os03t0243600-01

Locus

Os03g0243600

Description

Acyl-CoA-binding protein , Stress response

RAP-DB Gene Symbol Synonym(s)

OsACBP5

RAP-DB Gene Name Synonym(s)

Acyl-CoA-binding protein 5

CGSNL Gene Symbol

ACBP5

CGSNL Gene Name

ACYL-COA-BINDING PROTEIN5

Oryzabase Gene Symbol Synonym(s)

OsACBP5

Oryzabase Gene Name Synonym(s)

Acyl-CoA-binding protein 5

Transcript Evidence

AK072916

Protein Evidence

Q10P83

Literature

PMID: 24738983

PMID: 21128943

Note

Manual Curation

February 16, 2015

Gene Ontology (GO)

Molecular Function: fatty-acyl-CoA binding (GO:0000062)

Functional domain (InterPro)

FERM/acyl-CoA-binding protein, 3-helical bundle (IPR014352)

Acyl-CoA-binding protein, ACBP (IPR000582)

Full-length cDNA

J023149A14 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0243600-01)

Others

Oryzabase (18295)

KEGG (Os03t0243600-01)

Transcript

2203 bp

>Os03t0243600-01 Acyl-CoA-binding protein , Stress response
GGTTGCTCGATCGTCTCGCTCTCCTCTCCTCTTCTCTTCGTCTCTCCTCCTGACCCTTTT
TCCGCTTTCCCTTTTCCCCCCTCCTCGATCCGCGGCGCAACCGAACACGAAAGCGAGAGA
GAGAGGAGTGCAGCCGCTGCCCTGTCCCCTCACCGCGCCGCGCCGACATGGAGCTGTTCT
ACGAGCTGCTCCTCACGGCGGCTGCCTCCCTCCTCGTCGCCTTCCTGCTGGCCAGGCTGC
TGGCCTCCGCCGCCACCGCCAGTGATCCCCGCCGCCGCGCGCCCGATCACGCCGCCGTGA
TCGCGGAGGAGGAGGCGGTGGTGGTGGAGGAGGAGAGGATCATCGAGGTCGATGAGGTCG
AGGTGAAGAGCGCGCGCGCGAGGGAGTGCGTGGTTTCGGAGGGGTGGGTCGAGGTGGGGA
GGGCCTCGTCGGCGGAGGGGAAGCTCGAGTGCTTGCCGGAGGAAGAGGAGGCTCCCGCGA
AGGCCGCTCGGGAGCTTGTTCTCGATGCCGTTTTGGAGGAACGCGAGGAGGAAGGACAAG
TTGGCGAAGAGCGGTGCGATTTGGCCGCTGCGGTGGCGGAGGTCGTGGGAGTGAAGCCGC
ATGAGTTGGGGGTTGAAGCTGCTCCCGGGGAGGTATCTGACGTGACGCTGGAGGAAGGGA
AGGTGCAGGATGTTGGGGTGGAGCAGCATGATTTGGTCGCCGAGGCTGCTCCAAGGGAAG
CTCTTGACACAGGGTTGGAGAAACAGGGTGTTCCCATCATTGAAGCGGTTGAAATCAAGC
GGCAGGATGATCTGGGTGCTGAGGTAGCTCCGAGTGACGTTCCTGAGGTGGAATTTGAGC
AACAGGGAGTTCGCATTATTGAAGCTATTGATGTGAATCAACATCATCGGGTTGCTCTGG
CTGCTCCTGCGGAAGTTGTTGATGCGGGATTGGAGGAGAGGGTCCAAGCTATTGAAGCAG
GGTCATCTGGATTGACTTCCGAGACAGTTCCTGAAGAGGTTCTTGACGAGTTATCTGAGA
AGCAAGAAGAGCAAGTTATTGAAGAGAAGGAACATCAATTGGCTGCAGCGACTGCTCCAG
TAGCAATTCCTGGTGTGGCATTGGCAGAGACGGAGGAACTTAAAGAAGAACAATCCTCTG
AAAAAGCTGTCAATGTTCATGAAGAAGTTCAGAGTAAGGACGAAGCTAAATGCAAGCTCC
ATCTGGTTGATCAACAAGAAGGTTCGGCTTCTAAGGTGGAGCTGGTGGGGAGGAATACCG
ACAATGTGGAAATTAGCCATGGAAGCAGTTCTGGTGACAAAATGATTGCTGAGTTGACCG
AGGAGGAATTGACATTGCAAGGTGTGCCCGCAGATGAGACTCAGACAGACATGGAATTTG
GGGAGTGGGAAGGGATTGAAAGAACTGAGATAGAAAAGAGGTTTGGTGTGGCAGCAGCGT
TTGCATCTAGTGACGCCGGGATGGCTGCCCTGTCAAAGCTTGATAGTGATGTGCAGCTGC
AGCTGCAGGGACTCCTTAAGGTTGCCATTGATGGTCCATGCTATGACTCTACACAGCCAC
TTACCTTGAGGCCTTCATCTCGTGCAAAATGGGCTGCTTGGCAAAAGCTAGGGAACATGT
ATCCGGAGACAGCTATGGAAAGATACATGAATCTTTTGTCAGAGGCTATTCCAGGATGGA
TGGGTGACAATATCTCGGGCACAAAGGAACATGAAGCTGGTGATGATGCTGTAGGGTCTG
TCTTAACAATGACTTCAAATACAATCAACCAACATGACAGTCAAGGGAATGAAGACAATA
CTGGCATGTATGAAGGTCACTTGACAAGTTCCCCTAACCCAGAGAAAGGACAGAGTTCTG
ACATCCCTGCTGAATGAACATAACACTCATGGAAGATTTCTTGCATCAGTGATTTCAGCC
CATTGCTGAGACCGCTACCGATGCCTTCCTCATAAGATTAGATTTGTACAGTGCTCCTGT
GGTGCTAATATTAGTGTTGTCATGGTGTTGGTTTGTGTATATATATGACTGTATATATCA
GTAACTGCCGGTCCTACTGCGTGTATTCCGCCAGCAGCAGACTTATCATCTGGTATTCTG
GTGTAGTCTGTAGAACAATACATCTGGTGAGTCGTAATTATATGTCGATACGATGCAGTT
TGGAAGGAGAAATTGAAGTGGTTGGAAAACCAGTTGAAAGGAC

CDS

1710 bp

>Os03t0243600-01 Acyl-CoA-binding protein , Stress response
ATGGAGCTGTTCTACGAGCTGCTCCTCACGGCGGCTGCCTCCCTCCTCGTCGCCTTCCTG
CTGGCCAGGCTGCTGGCCTCCGCCGCCACCGCCAGTGATCCCCGCCGCCGCGCGCCCGAT
CACGCCGCCGTGATCGCGGAGGAGGAGGCGGTGGTGGTGGAGGAGGAGAGGATCATCGAG
GTCGATGAGGTCGAGGTGAAGAGCGCGCGCGCGAGGGAGTGCGTGGTTTCGGAGGGGTGG
GTCGAGGTGGGGAGGGCCTCGTCGGCGGAGGGGAAGCTCGAGTGCTTGCCGGAGGAAGAG
GAGGCTCCCGCGAAGGCCGCTCGGGAGCTTGTTCTCGATGCCGTTTTGGAGGAACGCGAG
GAGGAAGGACAAGTTGGCGAAGAGCGGTGCGATTTGGCCGCTGCGGTGGCGGAGGTCGTG
GGAGTGAAGCCGCATGAGTTGGGGGTTGAAGCTGCTCCCGGGGAGGTATCTGACGTGACG
CTGGAGGAAGGGAAGGTGCAGGATGTTGGGGTGGAGCAGCATGATTTGGTCGCCGAGGCT
GCTCCAAGGGAAGCTCTTGACACAGGGTTGGAGAAACAGGGTGTTCCCATCATTGAAGCG
GTTGAAATCAAGCGGCAGGATGATCTGGGTGCTGAGGTAGCTCCGAGTGACGTTCCTGAG
GTGGAATTTGAGCAACAGGGAGTTCGCATTATTGAAGCTATTGATGTGAATCAACATCAT
CGGGTTGCTCTGGCTGCTCCTGCGGAAGTTGTTGATGCGGGATTGGAGGAGAGGGTCCAA
GCTATTGAAGCAGGGTCATCTGGATTGACTTCCGAGACAGTTCCTGAAGAGGTTCTTGAC
GAGTTATCTGAGAAGCAAGAAGAGCAAGTTATTGAAGAGAAGGAACATCAATTGGCTGCA
GCGACTGCTCCAGTAGCAATTCCTGGTGTGGCATTGGCAGAGACGGAGGAACTTAAAGAA
GAACAATCCTCTGAAAAAGCTGTCAATGTTCATGAAGAAGTTCAGAGTAAGGACGAAGCT
AAATGCAAGCTCCATCTGGTTGATCAACAAGAAGGTTCGGCTTCTAAGGTGGAGCTGGTG
GGGAGGAATACCGACAATGTGGAAATTAGCCATGGAAGCAGTTCTGGTGACAAAATGATT
GCTGAGTTGACCGAGGAGGAATTGACATTGCAAGGTGTGCCCGCAGATGAGACTCAGACA
GACATGGAATTTGGGGAGTGGGAAGGGATTGAAAGAACTGAGATAGAAAAGAGGTTTGGT
GTGGCAGCAGCGTTTGCATCTAGTGACGCCGGGATGGCTGCCCTGTCAAAGCTTGATAGT
GATGTGCAGCTGCAGCTGCAGGGACTCCTTAAGGTTGCCATTGATGGTCCATGCTATGAC
TCTACACAGCCACTTACCTTGAGGCCTTCATCTCGTGCAAAATGGGCTGCTTGGCAAAAG
CTAGGGAACATGTATCCGGAGACAGCTATGGAAAGATACATGAATCTTTTGTCAGAGGCT
ATTCCAGGATGGATGGGTGACAATATCTCGGGCACAAAGGAACATGAAGCTGGTGATGAT
GCTGTAGGGTCTGTCTTAACAATGACTTCAAATACAATCAACCAACATGACAGTCAAGGG
AATGAAGACAATACTGGCATGTATGAAGGTCACTTGACAAGTTCCCCTAACCCAGAGAAA
GGACAGAGTTCTGACATCCCTGCTGAATGA

Protein

570 aa

>Os03t0243600-01 Acyl-CoA-binding protein , Stress response
MELFYELLLTAAASLLVAFLLARLLASAATASDPRRRAPDHAAVIAEEEAVVVEEERIIE
VDEVEVKSARARECVVSEGWVEVGRASSAEGKLECLPEEEEAPAKAARELVLDAVLEERE
EEGQVGEERCDLAAAVAEVVGVKPHELGVEAAPGEVSDVTLEEGKVQDVGVEQHDLVAEA
APREALDTGLEKQGVPIIEAVEIKRQDDLGAEVAPSDVPEVEFEQQGVRIIEAIDVNQHH
RVALAAPAEVVDAGLEERVQAIEAGSSGLTSETVPEEVLDELSEKQEEQVIEEKEHQLAA
ATAPVAIPGVALAETEELKEEQSSEKAVNVHEEVQSKDEAKCKLHLVDQQEGSASKVELV
GRNTDNVEISHGSSSGDKMIAELTEEELTLQGVPADETQTDMEFGEWEGIERTEIEKRFG
VAAAFASSDAGMAALSKLDSDVQLQLQGLLKVAIDGPCYDSTQPLTLRPSSRAKWAAWQK
LGNMYPETAMERYMNLLSEAIPGWMGDNISGTKEHEAGDDAVGSVLTMTSNTINQHDSQG
NEDNTGMYEGHLTSSPNPEKGQSSDIPAE*

5'UTR

chr03:7591870..7592036 (+ strand) : 167 bp

CDS

chr03:7592037..7593460 (+ strand) : 1424 bp

chr03:7595761..7595866 (+ strand) : 106 bp

chr03:7595971..7596059 (+ strand) : 89 bp

chr03:7596348..7596409 (+ strand) : 62 bp

chr03:7597051..7597079 (+ strand) : 29 bp

3'UTR

chr03:7597080..7597405 (+ strand) : 326 bp

FASTA

>Os03t0243600-01 class=Sequence position=chr03:7591870..7597405 (+ strand)
GGTTGCTCGA TCGTCTCGCT CTCCTCTCCT CTTCTCTTCG TCTCTCCTCC TGACCCTTTT TCCGCTTTCC CTTTTCCCCC
CTCCTCGATC CGCGGCGCAA CCGAACACGA AAGCGAGAGA GAGAGGAGTG CAGCCGCTGC CCTGTCCCCT CACCGCGCCG
CGCCGACATG GAGCTGTTCT ACGAGCTGCT CCTCACGGCG GCTGCCTCCC TCCTCGTCGC CTTCCTGCTG GCCAGGCTGC
TGGCCTCCGC CGCCACCGCC AGTGATCCCC GCCGCCGCGC GCCCGATCAC GCCGCCGTGA TCGCGGAGGA GGAGGCGGTG
GTGGTGGAGG AGGAGAGGAT CATCGAGGTC GATGAGGTCG AGGTGAAGAG CGCGCGCGCG AGGGAGTGCG TGGTTTCGGA
GGGGTGGGTC GAGGTGGGGA GGGCCTCGTC GGCGGAGGGG AAGCTCGAGT GCTTGCCGGA GGAAGAGGAG GCTCCCGCGA
AGGCCGCTCG GGAGCTTGTT CTCGATGCCG TTTTGGAGGA ACGCGAGGAG GAAGGACAAG TTGGCGAAGA GCGGTGCGAT
TTGGCCGCTG CGGTGGCGGA GGTCGTGGGA GTGAAGCCGC ATGAGTTGGG GGTTGAAGCT GCTCCCGGGG AGGTATCTGA
CGTGACGCTG GAGGAAGGGA AGGTGCAGGA TGTTGGGGTG GAGCAGCATG ATTTGGTCGC CGAGGCTGCT CCAAGGGAAG
CTCTTGACAC AGGGTTGGAG AAACAGGGTG TTCCCATCAT TGAAGCGGTT GAAATCAAGC GGCAGGATGA TCTGGGTGCT
GAGGTAGCTC CGAGTGACGT TCCTGAGGTG GAATTTGAGC AACAGGGAGT TCGCATTATT GAAGCTATTG ATGTGAATCA
ACATCATCGG GTTGCTCTGG CTGCTCCTGC GGAAGTTGTT GATGCGGGAT TGGAGGAGAG GGTCCAAGCT ATTGAAGCAG
GGTCATCTGG ATTGACTTCC GAGACAGTTC CTGAAGAGGT TCTTGACGAG TTATCTGAGA AGCAAGAAGA GCAAGTTATT
GAAGAGAAGG AACATCAATT GGCTGCAGCG ACTGCTCCAG TAGCAATTCC TGGTGTGGCA TTGGCAGAGA CGGAGGAACT
TAAAGAAGAA CAATCCTCTG AAAAAGCTGT CAATGTTCAT GAAGAAGTTC AGAGTAAGGA CGAAGCTAAA TGCAAGCTCC
ATCTGGTTGA TCAACAAGAA GGTTCGGCTT CTAAGGTGGA GCTGGTGGGG AGGAATACCG ACAATGTGGA AATTAGCCAT
GGAAGCAGTT CTGGTGACAA AATGATTGCT GAGTTGACCG AGGAGGAATT GACATTGCAA GGTGTGCCCG CAGATGAGAC
TCAGACAGAC ATGGAATTTG GGGAGTGGGA AGGGATTGAA AGAACTGAGA TAGAAAAGAG GTTTGGTGTG GCAGCAGCGT
TTGCATCTAG TGACGCCGGG ATGGCTGCCC TGTCAAAGCT TGATAGTGAT GTGCAGCTGC AGCTGCAGGG ACTCCTTAAG
GTTGCCATTG ATGGTCCATG CTATGACTCT ACACAGCCAC TTACCTTGAG GCCTTCATCT CGTGCAAAAT GGTAATTGTT
TTTCTCATTG ATATCCTAGC TCCAACTTTT TTTTTGGTAT GCTGCACAAC TGCGGTAGGT TATATAGTTC AAGGACAACA
AAACCAATAT ACTACCCAAA TGCCTTACTT TGCACTGGCT AGAATGTAAT CGGCAATGGA CTTGTGATTT ATAGGCAGAT
CAGGTATACT GGTCTGAAAT AGCTTAAACT AGTCCTTTTT TTGGCAAAAG ACCAAAGTAC AGAACTTTGA ACTCTGAATT
CTGGGTAGTT GGTAGATAGA CTGTAATGAC ATATTAGAAA ACTGAATTGT TTGATCTGCT GGTCTGTTTG ATCTAGTTGG
GACTTCTTAT GGCTACTATG ACACTTATGT ATGAAATTTG GTCCTAGCTA TTTGGCTAAA CCTAAAAAAG AGCCAAAGAA
CTGGTTCAAA ATTTTGAATC CCATTTTACT GCGGAACATA GAACTTCTCT GTGGAACAAT AAACGACTCA TATAATGCAA
AAGTTTTTAA TCTTTTGCAT AATTGATTGT TAAAATTAGA AAAATATTTT CCTACCTTAT GTTGTGACTT GAGACAATGA
GAATCTGTCC TCTAATTTGT TAAGGGGAAA AAAAGCTTCT GTCAACTTTT CTGGGCTATC TAAACAAAGA CATTAAATGT
GCCATTTTTG TTTTATATTG TTTAATAAAC TTGTTATGCT AAAAGAAGAT AATTATAGTT GTCCATCATC AGTGAAGATA
AAGATAAGTG AATTATAATT GCCCATCATC AATGGGATAA TGCACTTAAA CCAGTGATAT AGTGTGTAAT AGTGTAAGGA
TGTCACTGAT ACGCTGATCT TCTGTCATGC ATAATGGTGT GTGGTTCACA TGAGAATCTA TCAAGTTTTT GGGATAAGTT
GCAAGTGAAG GCAAAGCAAA GCATATGAAA AGCATAGTAT TTTTAGAGGT ATCAATCCAG TGTTACTTGG CCGCACTGCA
AGGTAGTTAT TCATATAAAC AGGCCAAAAC ACTTCATCTA TGTATGCCCA ACATGATATA ACTGTGACAT GAGTGCAGGA
CACACATATT GCAATATTCC ATGCTTAATG CAGTCAGATT TGTAATTTGG AGTGCTTCTC CGAGATAGTT TGTAACTAAT
CATGTAGCTA CTATTTGGAA TCCAAAAATG GACAAAATCC AATGTCAAAT ATATGATGTA AGCAGTTATT GAGATGCTGA
TACGCTAGGT ATTTCTCTTG TTGGACATAA TTATATATGA GTATATCATT GAACTATAGG TATTTTGTCA AAGCTACCTA
AAACGATGCA TTTGAGTTGA TTCAATAATT ATATCTTAAC TGAATACCTT TATATATGAC AAAACCTAAA TGGTGGGCGA
CCCCCTTTTC ATCTCCCATA TTTGGCATGT GGGACCCACC TGTTAGTTGC ATACTTGCAT GTGATAGACA ATTATAGTAC
TCCTGTCACT TTTGAACATT TATTCTTTTT ACTATGAGTT TTTCCACAAA TACTTGTCAC TTCACAGTCT CAATCAATCA
ATTTTTGTTT GCATAGAGCG CCCCTGTTAG TTCTATATGT GCCACCATGT AATTCAATAT CATATACTTG GAGTGCAGAG
GTAGCATATA CTTACAAAAT GGGACCTATC AAAAAAATTA CTAGTTGAAT TTTTTTCACT GGTATTATGA TATGCCATCG
AATGACTGAT TCCAGCCAGA TTTCCTATGA TAAATGAGAG TAATGATCAC AAATTCAAAG AATTTTCATA TGTTTTGCAT
GTGCGCAGCA CCTTATCTCT CATTTGTTGG TTGTGTAGCC TTTTTATATT GATTCTTTAA ATGGGTTGCT GCCAAAAGCG
GAGCGGGGCC TGTGTCTAAC CATAACAATT ACCCTTTGGT TGAGTGAGAA CCTAGATGTT TTAGAATATG GAATGCTGGT
CACATAATAT ACATGATGTG ACAGCATCAC AGCACTGACA TCTTGCACCT ATCTCTCTAT GTTAAGGCTT TCTATTTAGT
ATAATGGTAG TTGGTTGACA ATCTATAGTC ATATTCATAT ATGCCTGTAA GTAATTCTGG AGTTATACTT GCAGTAACTA
TATATAACTT GGCTACTTAT ATTTTTTATT TCCAAAAATT ATAGGGAATG TATGTTGGAC TATATGAAAA ATTATAAGTT
GTAAATAGAC ATAAGGAAAG ACACACAAGA TGGTGGGCTA TTTGTTTGTA GGAGTTGTAC AATTCTGTTA AGCTGCATAC
GAGTCACAGT CTGTAATGAT AACCCATAAC TATCGTGTAT TATTCTCTCA GGGCTGCTTG GCAAAAGCTA GGGAACATGT
ATCCGGAGAC AGCTATGGAA AGATACATGA ATCTTTTGTC AGAGGCTATT CCAGGATGGA TGGGTGACAA TATCTCGGTA
AGTTTTTCTA TGGGTGCCAA AGTGTTACTT CTGTTTATTG CATTGTTTTT TTACACCAGA CTGGACAATA GTTCTAATCA
TTTCGAAATA CTGTACTCTA GGGCACAAAG GAACATGAAG CTGGTGATGA TGCTGTAGGG TCTGTCTTAA CAATGACTTC
AAATACAATC AACCAACATG ACAGTCAAGG GTAATTTACT CATTTACTGT AGTGTGAAAC CTGGAATGTA GCAAAGTGTT
GACAGGGCTG ACCATACCGA TGATATACCT GCCATACTAA CTAGTAGTAT TTGTTAGTGC TGGTATAAGA ATATCTTAAA
TGAAATTCCT GGCTCTTTAG CTGTACCAGT TCTTTTTTAC AATGGCAATA TCTACGAGTC CCAACTGGTA TAACTCAATC
TGGTACGGTA ACCTTGATTT AGAAGTGTTT CTAATGTTTA TTACCATGGC TTGCTCCTGC TGATGGATTT CTTGGCAGGA
ATGAAGACAA TACTGGCATG TATGAAGGTC ACTTGACAAG TTCCCCTAAC CCAGAGAAAG GTACGTACTT GTCATATTTT
CGGCAGTGAA CCAGGATTTT TTTTATCTGG CTCCTAAAAG TAAAATATTG CAATTCATTA GTGACCAGTG TTGTGTATTT
ATGCATGACG ACTGGTTCAG GTGCATTTGT GAAATTAACT TCTGATAGCT ATCTATCATT TTTTTGCCTG CACCCTCTGT
GATCTCCACT TTGTTAACCA CATTTTGTAA GGAAAACTAA ATTACAAGGA GTATCTCCTG CGTGTTTGAG AAAAAAAAAC
TTATGGAGTA TATTGCATTT CATTAGTGGT AGTTCTCCTG CCATGCATGT GTTGTGCTTG CTAACCATTT AATTCCAAGT
TAATGTTTTT CTACACCATA ATTAAACAAA CTACTCCCTC ATTCTTTTTT TACTTGCTAT TTCAGGCATA GGTGCAGATC
ACAATGCATG CATTTGACCG TTACATTACT GAACTTATTT AGAAAATGAT ATCTAAAGTA ATTTTGTGAA AAAAAAATCT
GCTAATACCA TTTCAGTGTG AAAATAGTAT AAACATTTTT AGTCAAAGAA TGGAAGTGTA CCGTTCCTCT ATTTCAGTAT
GTTTCTGTTT GATTACTTCG TCAATCAATT TCATGAATTC AACCCGCCAC TAAATTTTCA GGACAGAGTT CTGACATCCC
TGCTGAATGA ACATAACACT CATGGAAGAT TTCTTGCATC AGTGATTTCA GCCCATTGCT GAGACCGCTA CCGATGCCTT
CCTCATAAGA TTAGATTTGT ACAGTGCTCC TGTGGTGCTA ATATTAGTGT TGTCATGGTG TTGGTTTGTG TATATATATG
ACTGTATATA TCAGTAACTG CCGGTCCTAC TGCGTGTATT CCGCCAGCAG CAGACTTATC ATCTGGTATT CTGGTGTAGT
CTGTAGAACA ATACATCTGG TGAGTCGTAA TTATATGTCG ATACGATGCA GTTTGGAAGG AGAAATTGAA GTGGTTGGAA
AACCAGTTGA AAGGAC

Locus: Os03g0243600

Loading...

Locus: Os03g0243600

Loading...