Os03t0244600-01

Locus

Os03g0244600

Description

Similar to AUX1-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLAX2, OsRAU2, OsAUX3, LAX2, RAU2, AUX3

Oryzabase Gene Name Synonym(s)

like aux1-2, related to AUX1-2, auxin transporter 3

Transcript Evidence

AK103524 (DDBJ, Best hit)

Protein Evidence

B6TPT6 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Amino acid transporter, transmembrane (IPR013057)

Full-length cDNA

J033131K12 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0244600-01)

RiceXPro (AK103524)

Others

Oryzabase (11917)

KEGG (Os03t0244600-01)

Transcript

1962 bp

>Os03t0244600-01 Similar to AUX1-like protein.
ATATCCTCTCCTACGATACTGCGCGCTCAGCACAGAAGAGGAAGGTATCTTAACTAGCCC
AGGATACCACCACACACCGAGTACTGTTACGTGTTCACGGTCTAGCTAAGCAGTGATCAT
GGGCTCGGCGGCTGACGGGAGCCTCGCCAACGAGAAGGCGCCGGCCGAGACGGTCGGCGT
CGGCCGTTACGTCGAAATGGAGCAGGACGGCGGCGGACCCAGCACCGCAAAGTCCCGGCT
CTCCGGCCTTCTCTGGCACGGCGGCTCAGCCTACGACGCCTGGTTCAGCTGCGCGTCCAA
CCAGGTGGCCCAGGTGCTCCTGACGCTGCCCTACTCGTTCTCCCAGCTGGGGATGCTCAG
CGGCATACTGTTCCAGCTCTTCTACGGGCTGTTGGGCAGCTGGACGGCGTATCTCATCAG
CATCCTGTACGTGGAGTACAGGACCAGGAAGGAGAGGGAGAAGGTGGACTTCAGGAACCA
TGTCATCCAGTGGTTCGAGGTGCTGGACGGCCTGCTGGGGAGGCATTGGAGAAACGTCGG
CCTGGCCTTCAACTGCACCTTCCTACTCTTCGGCTCCGTCATCCAGCTCATCGCCTGCGC
TAGCAACATCTACTACATCAACGACAAGCTGGACAAGAGGACGTGGACCTACATCTTCGG
CGCGTGCTGCGCGACGACGGTGTTCATCCCGTCGTTCCACAACTACCGGATCTGGTCATT
CCTCGGCCTCGTCATGACCACCTACACGGCCTGGTACCTCGCCGTCGCCTCCCTCATCCA
TGGCCAGGTCGATGGAGTGAAGCACTCGGGCCCTACAAAGATGGTCCTCTACTTCACCGG
GGCCACAAACATTCTCTACACCTTCGGTGGGCACGCTGTTACTGTGGAGATCATGCACGC
GATGTGGAGGCCGCAGAAGTTCAAGGCGATCTACCTGATGGCGACGCTGTACGTGCTGAC
GCTGACGCTGCCGTCGGCGGCGAGCGTGTACTGGGCGTTCGGGGACGAGCTGCTCACGCA
CTCGAATGCGCTGGCGCTGCTGCCGCGCACGGCGTTCCGGGACGCCGCCGTGGTGCTCAT
GCTCATCCACCAGTTCATCACCTTCGGCTTCGCCTGCACGCCGCTCTACTTCGTCTGGGA
GAAGCTCATCGGACTCCACGACTGCCGCAGCCTCTTCAAGCGCGCCGCCGCGAGGCTCCC
CGTCGTCGTGCCCATCTGGTTCCTCGCCATCATCTTCCCCTTCTTCGGGCCCATCAACTC
CGCCGTCGGCTCCCTCCTCGTCAGCTTCACCGTCTACATCATCCCCGCCCTCGCGCACAT
GATCACCTTCCGCTCCGCGCACGCTCGTGAGAACGCCGTGGAGCCGCCGCCGCGGTTCGT
GGGGCGATGGACGGGCACGTTCATCATCAACGCGTTCGTGGTGGCGTGGGTGCTGGTGGT
CGGCTTCGGGTTCGGCGGCTGGGCCAGCATGACCAACTTCGTCCGCCAGATCGACACGTT
CGGGCTCTTCACCAAGTGCTACCAGTGCccgccgccccctctgccgccggcgggcgccgc
tccgaacgccacctggccgccgttcccggcgacgccgttcaacgccaccaccgccggcct
cgctccggcccctgctccttcgccggcgcatttcttcggccgccaccaccggcatcacag
ccaCGGGCTCTGAACACTGAAATGTACGTACCAGGGCAATGCTCGAGCTTTGGTTTAGCT
ATAGTTGTTCACTAGCGCCGTCACTAATTAGTCTTAGCTTAGCACAAAGCTGCATCTTCT
CTAGCTATCAGTAGCATGTCAGTCAGACGGAGTATCCCGTTTCAAGTTCCTTGGTTCTGT
ACTGCCTCCTGGCGTGGAGCTCAAAAAACGAACAGAAAAAAAGGGAATGTTGCTACGGCC
GCAGATGCAAGAGCCAGCTAATCTAGCCTCTTTACTTTCTCT

CDS

1575 bp

>Os03t0244600-01 Similar to AUX1-like protein.
ATGGGCTCGGCGGCTGACGGGAGCCTCGCCAACGAGAAGGCGCCGGCCGAGACGGTCGGC
GTCGGCCGTTACGTCGAAATGGAGCAGGACGGCGGCGGACCCAGCACCGCAAAGTCCCGG
CTCTCCGGCCTTCTCTGGCACGGCGGCTCAGCCTACGACGCCTGGTTCAGCTGCGCGTCC
AACCAGGTGGCCCAGGTGCTCCTGACGCTGCCCTACTCGTTCTCCCAGCTGGGGATGCTC
AGCGGCATACTGTTCCAGCTCTTCTACGGGCTGTTGGGCAGCTGGACGGCGTATCTCATC
AGCATCCTGTACGTGGAGTACAGGACCAGGAAGGAGAGGGAGAAGGTGGACTTCAGGAAC
CATGTCATCCAGTGGTTCGAGGTGCTGGACGGCCTGCTGGGGAGGCATTGGAGAAACGTC
GGCCTGGCCTTCAACTGCACCTTCCTACTCTTCGGCTCCGTCATCCAGCTCATCGCCTGC
GCTAGCAACATCTACTACATCAACGACAAGCTGGACAAGAGGACGTGGACCTACATCTTC
GGCGCGTGCTGCGCGACGACGGTGTTCATCCCGTCGTTCCACAACTACCGGATCTGGTCA
TTCCTCGGCCTCGTCATGACCACCTACACGGCCTGGTACCTCGCCGTCGCCTCCCTCATC
CATGGCCAGGTCGATGGAGTGAAGCACTCGGGCCCTACAAAGATGGTCCTCTACTTCACC
GGGGCCACAAACATTCTCTACACCTTCGGTGGGCACGCTGTTACTGTGGAGATCATGCAC
GCGATGTGGAGGCCGCAGAAGTTCAAGGCGATCTACCTGATGGCGACGCTGTACGTGCTG
ACGCTGACGCTGCCGTCGGCGGCGAGCGTGTACTGGGCGTTCGGGGACGAGCTGCTCACG
CACTCGAATGCGCTGGCGCTGCTGCCGCGCACGGCGTTCCGGGACGCCGCCGTGGTGCTC
ATGCTCATCCACCAGTTCATCACCTTCGGCTTCGCCTGCACGCCGCTCTACTTCGTCTGG
GAGAAGCTCATCGGACTCCACGACTGCCGCAGCCTCTTCAAGCGCGCCGCCGCGAGGCTC
CCCGTCGTCGTGCCCATCTGGTTCCTCGCCATCATCTTCCCCTTCTTCGGGCCCATCAAC
TCCGCCGTCGGCTCCCTCCTCGTCAGCTTCACCGTCTACATCATCCCCGCCCTCGCGCAC
ATGATCACCTTCCGCTCCGCGCACGCTCGTGAGAACGCCGTGGAGCCGCCGCCGCGGTTC
GTGGGGCGATGGACGGGCACGTTCATCATCAACGCGTTCGTGGTGGCGTGGGTGCTGGTG
GTCGGCTTCGGGTTCGGCGGCTGGGCCAGCATGACCAACTTCGTCCGCCAGATCGACACG
TTCGGGCTCTTCACCAAGTGCTACCAGTGCccgccgccccctctgccgccggcgggcgcc
gctccgaacgccacctggccgccgttcccggcgacgccgttcaacgccaccaccgccggc
ctcgctccggcccctgctccttcgccggcgcatttcttcggccgccaccaccggcatcac
agccaCGGGCTCTGA

Protein

525 aa

>Os03t0244600-01 Similar to AUX1-like protein.
MGSAADGSLANEKAPAETVGVGRYVEMEQDGGGPSTAKSRLSGLLWHGGSAYDAWFSCAS
NQVAQVLLTLPYSFSQLGMLSGILFQLFYGLLGSWTAYLISILYVEYRTRKEREKVDFRN
HVIQWFEVLDGLLGRHWRNVGLAFNCTFLLFGSVIQLIACASNIYYINDKLDKRTWTYIF
GACCATTVFIPSFHNYRIWSFLGLVMTTYTAWYLAVASLIHGQVDGVKHSGPTKMVLYFT
GATNILYTFGGHAVTVEIMHAMWRPQKFKAIYLMATLYVLTLTLPSAASVYWAFGDELLT
HSNALALLPRTAFRDAAVVLMLIHQFITFGFACTPLYFVWEKLIGLHDCRSLFKRAAARL
PVVVPIWFLAIIFPFFGPINSAVGSLLVSFTVYIIPALAHMITFRSAHARENAVEPPPRF
VGRWTGTFIINAFVVAWVLVVGFGFGGWASMTNFVRQIDTFGLFTKCYQCPPPPLPPAGA
APNATWPPFPATPFNATTAGLAPAPAPSPAHFFGRHHRHHSHGL*

5'UTR

chr03:7646649..7646766 (+ strand) : 118 bp

CDS

chr03:7646767..7646952 (+ strand) : 186 bp

chr03:7647086..7647271 (+ strand) : 186 bp

chr03:7647383..7647495 (+ strand) : 113 bp

chr03:7647591..7647774 (+ strand) : 184 bp

chr03:7647911..7648008 (+ strand) : 98 bp

chr03:7648681..7649146 (+ strand) : 466 bp

chr03:7649910..7650251 (+ strand) : 342 bp

3'UTR

chr03:7650252..7650520 (+ strand) : 269 bp

FASTA

>Os03t0244600-01 class=Sequence position=chr03:7646649..7650520 (+ strand)
ATATCCTCTC CTACGATACT GCGCGCTCAG CACAGAAGAG GAAGGTATCT TAACTAGCCC AGGATACCAC CACACACCGA
GTACTGTTAC GTGTTCACGG TCTAGCTAAG CAGTGATCAT GGGCTCGGCG GCTGACGGGA GCCTCGCCAA CGAGAAGGCG
CCGGCCGAGA CGGTCGGCGT CGGCCGTTAC GTCGAAATGG AGCAGGACGG CGGCGGACCC AGCACCGCAA AGTCCCGGCT
CTCCGGCCTT CTCTGGCACG GCGGCTCAGC CTACGACGCC TGGTTCAGCT GCGCGTCCAA CCAGGTGACC ACATTTTCTG
ATCGACGCTA TGCTTGCTTC CATTTTCTTG CGAAATGCAT GCAATCTAAG GTAGGTTTGT GCCGTGATCG ATGTGTAGCC
GTTCGGTTAA ATCTGCATTG CTGTGTGCTT CGATCAGGTG GCCCAGGTGC TCCTGACGCT GCCCTACTCG TTCTCCCAGC
TGGGGATGCT CAGCGGCATA CTGTTCCAGC TCTTCTACGG GCTGTTGGGC AGCTGGACGG CGTATCTCAT CAGCATCCTG
TACGTGGAGT ACAGGACCAG GAAGGAGAGG GAGAAGGTGG ACTTCAGGAA CCATGTCATC CAGGTAAACA AAAACTACAT
TGTTCAAATC CATTTCGCCG CCGTACGGTC TTCTCTTCTC TGTATGTTCT GTAAGTTCAG ACCCTGAAGA CTTCAACCAT
TGATGTGCAT GCAGTGGTTC GAGGTGCTGG ACGGCCTGCT GGGGAGGCAT TGGAGAAACG TCGGCCTGGC CTTCAACTGC
ACCTTCCTAC TCTTCGGCTC CGTCATCCAG CTCATCGCCT GCGCTAGGTA CGTACCTGCA GCTACTAAAG CCACTGAAGT
CTGAATGTAC TCATTAGTAT CTGTTTTAGC GTCTGTTTTA TGTGTACAAT GTGTGAGTGC AGCAACATCT ACTACATCAA
CGACAAGCTG GACAAGAGGA CGTGGACCTA CATCTTCGGC GCGTGCTGCG CGACGACGGT GTTCATCCCG TCGTTCCACA
ACTACCGGAT CTGGTCATTC CTCGGCCTCG TCATGACCAC CTACACGGCC TGGTACCTCG CCGTCGCCTC CCTCATCCAT
GGCCAGGTAG TACAACACAA AAGCACCATC TGTTAGCATG CAGCATGCTT GCATTTCTCG TCTGAATAGC GAGGCGCATG
CCTGAACATT ATTACATTGC GTTGTGCTGA AAAAACACTT GTGTTTTTTG TATGAATATC AGGTCGATGG AGTGAAGCAC
TCGGGCCCTA CAAAGATGGT CCTCTACTTC ACCGGGGCCA CAAACATTCT CTACACCTTC GGTGGGCACG CTGTTACTGT
GTAAGCCGAC AAACGCTCTC TATTCTATGC CCCTGTGTCA AAAGGAATAC TGCACGAAAT GGTCTCAGTC ACATGCCACA
CCGTAGAGAG TACCGTAGGC TGCAAATTTT CTTTTCTGAA ACTGCACAAA TTCAACAAGC CAGCACATTT CAGAAAAGCA
ACTACGACTC GAATCAAAGC ATCTACCCCG CACTGTTGCA TCTTTGGCAG CGAACCCATG CACTCCCATT TCCAGGCTAC
ACACTGGCAG GAGGAGTACT CCTCTGCTCA TTCATTCATG GTTTGGACAG TCAAAAGAGC TATAGCTAGC GTCCAAACTC
GGGAGAGCAT TTGCTGCTTT ACCTCAGGGT GGCTCCTGCG GCCTGCGCCT GCATTGCTGT AGATACGATG CCCATCCTGC
CATCCACCAC GGACCACGGA TGGACAACGC CACGAAACAT GCACGGACAA GGCACGGATG TCCACGTAAC TCTGTACCGT
GTACCCACGC TACGAGCTAG CAGTACAGTA AGGCAAAGGC AATAACGCCA CGCCTCCGCT CTCAGTATCT GGTCACCCTC
CTTGCAGGCT CGCAGTTACA TCGATCGTTT ACAGCAGCGT CAATACTGTA ATAATTGACC AAACTGTCAA AGCAGTTTGT
GACAACATTA CGTGTGATTT TGGTGCGCGC AGGGAGATCA TGCACGCGAT GTGGAGGCCG CAGAAGTTCA AGGCGATCTA
CCTGATGGCG ACGCTGTACG TGCTGACGCT GACGCTGCCG TCGGCGGCGA GCGTGTACTG GGCGTTCGGG GACGAGCTGC
TCACGCACTC GAATGCGCTG GCGCTGCTGC CGCGCACGGC GTTCCGGGAC GCCGCCGTGG TGCTCATGCT CATCCACCAG
TTCATCACCT TCGGCTTCGC CTGCACGCCG CTCTACTTCG TCTGGGAGAA GCTCATCGGA CTCCACGACT GCCGCAGCCT
CTTCAAGCGC GCCGCCGCGA GGCTCCCCGT CGTCGTGCCC ATCTGGTTCC TCGCCATCAT CTTCCCCTTC TTCGGGCCCA
TCAACTCCGC CGTCGGCTCC CTCCTCGTCA GCTTCACCGT CTACATCATC CCCGCCCTCG CGCACATGAT CACCTTCCGC
TCCGCGCACG CTCGTGAGGT ATAGTAAAAA TCTTGGCATC TTTTTAATCA CTGCGCTTTT TTTTTAACCT TTTGGTTTCA
CTTTTATCAT GCGAGTTTAC TAGTGTAGGA CTTGCATGTC GCATTGCACT TTACATTGGC ACGCCAAAGC TAGCTAGGTA
CTGATTAGAT GCCACTTAGC ACAGTGGTTA TACATTTATC AAGTGAGTTA GACGAATGCT AGTTGGGTCC ACCCTTGTTC
GGGATGGACT ATGGAAAGAT GCTGATACAA AAGGTAACCT TGGTTATGAT CAAGGGTGAA ACATCATTAG GGTGGTAAGT
ATTGCCGCTG CTTTTGTCGT ACTGAATGTA AGACAAAACT GCGGCAGTGT TGATCTGTCT TTTAACGTGG CAAGAAAAGC
AAAAGGGTGC TAGTACCAAG CTTAGAAGTA GACTGTTGAG GAAAAACAGG AGACAGAGGG CTCTTTTGTA CCATTCGTCC
TGGTATATTT GGACGAGCAT CGAACCACTC TCTTTGCAAG ACGACACAAA AAAGTTCAGT ACtactttct ccgtttcaca
atttaagtca ttctagtatt ttccacattc atattgatat taatgaatct agacatatat atgacttata ttataAAACG
GAGTGAGTAG CAAATTTAGA AGTCATGTGA TTTGTACTCA GTACTACATT TTAATGGAGT ACAAGCTAGT AGCTGTGTGC
TCTGTTGTTG TGATGGTGTG AGCCTGAACT GAGAATCCTT TGTCTGAATG CTAAACTGCA GAACGCCGTG GAGCCGCCGC
CGCGGTTCGT GGGGCGATGG ACGGGCACGT TCATCATCAA CGCGTTCGTG GTGGCGTGGG TGCTGGTGGT CGGCTTCGGG
TTCGGCGGCT GGGCCAGCAT GACCAACTTC GTCCGCCAGA TCGACACGTT CGGGCTCTTC ACCAAGTGCT ACCAGTGCcc
gccgccccct ctgccgccgg cgggcgccgc tccgaacgcc acctggccgc cgttcccggc gacgccgttc aacgccacca
ccgccggcct cgctccggcc cctgctcctt cgccggcgca tttcttcggc cgccaccacc ggcatcacag ccaCGGGCTC
TGAACACTGA AATGTACGTA CCAGGGCAAT GCTCGAGCTT TGGTTTAGCT ATAGTTGTTC ACTAGCGCCG TCACTAATTA
GTCTTAGCTT AGCACAAAGC TGCATCTTCT CTAGCTATCA GTAGCATGTC AGTCAGACGG AGTATCCCGT TTCAAGTTCC
TTGGTTCTGT ACTGCCTCCT GGCGTGGAGC TCAAAAAACG AACAGAAAAA AAGGGAATGT TGCTACGGCC GCAGATGCAA
GAGCCAGCTA ATCTAGCCTC TTTACTTTCT CT

Locus: Os03g0244600

Loading...

Locus: Os03g0244600

Loading...