Os03t0244600-02

Locus

Os03g0244600

Description

Similar to auxin transporter-like protein 3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLAX2, OsRAU2, OsAUX3, LAX2, RAU2, AUX3

Oryzabase Gene Name Synonym(s)

like aux1-2, related to AUX1-2, auxin transporter 3

Transcript Evidence

AK101329 (DDBJ, Best hit)

Protein Evidence

B6TPT6 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Amino acid transporter, transmembrane (IPR013057)

Full-length cDNA

J033034G17 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0244600-02)

RiceXPro (AK101329)

Others

Oryzabase (11917)

KEGG (Os03t0244600-02)

Transcript

1149 bp

>Os03t0244600-02 Similar to auxin transporter-like protein 3.
GATCGTTTACAGCAGCGTCAATACTGTAATAATTGACCAAACTGTCAAAGCAGTTTGTGA
CAACATTACGTGTGATTTTGGTGCGCGCAGGGAGATCATGCACGCGATGTGGAGGCCGCA
GAAGTTCAAGGCGATCTACCTGATGGCGACGCTGTACGTGCTGACGCTGACGCTGCCGTC
GGCGGCGAGCGTGTACTGGGCGTTCGGGGACGAGCTGCTCACGCACTCGAATGCGCTGGC
GCTGCTGCCGCGCACGGCGTTCCGGGACGCCGCCGTGGTGCTCATGCTCATCCACCAGTT
CATCACCTTCGGCTTCGCCTGCACGCCGCTCTACTTCGTCTGGGAGAAGCTCATCGGACT
CCACGACTGCCGCAGCCTCTTCAAGCGCGCCGCCGCGAGGCTCCCCGTCGTCGTGCCCAT
CTGGTTCCTCGCCATCATCTTCCCCTTCTTCGGGCCCATCAACTCCGCCGTCGGCTCCCT
CCTCGTCAGCTTCACCGTCTACATCATCCCCGCCCTCGCGCACATGATCACCTTCCGCTC
CGCGCACGCTCGTGAGAACGCCGTGGAGCCGCCGCCGCGGTTCGTGGGGCGATGGACGGG
CACGTTCATCATCAACGCGTTCGTGGTGGCGTGGGTGCTGGTGGTCGGCTTCGGGTTCGG
CGGCTGGGCCAGCATGACCAACTTCGTCCGCCAGATCGACACGTTCGGGCTCTTCACCAA
GTGCTACCAGTGCccgccgccccctctgccgccggcgggcgccgctccgaacgccacctg
gccgccgttcccggcgacgccgttcaacgccaccaccgccggcctcgctccggcccctgc
tccttcgccggcgcatttcttcggccgccaccaccggcatcacagccaCGGGCTCTGAAC
ACTGAAATGTACGTACCAGGGCAATGCTCGAGCTTTGGTTTAGCTATAGTTGTTCACTAG
CGCCGTCACTAATTAGTCTTAGCTTAGCACAAAGCTGCATCTTCTCTAGCTATCAGTAGC
ATGTCAGTCAGACGGAGTATCCCGTTTCAAGTTCCTTGGTTCTGTACTGCCTCCTGGCGT
GGAGCTCAAAAAACGAACAGAAAAAAAGGGAATGTTGCTACGGCCGCAGATGCAAGAGCC
AGCTAATCT

CDS

897 bp

>Os03t0244600-02 Similar to auxin transporter-like protein 3.
ATCGTTTACAGCAGCGTCAATACTGTAATAATTGACCAAACTGTCAAAGCAGTTTGTGAC
AACATTACGTGTGATTTTGGTGCGCGCAGGGAGATCATGCACGCGATGTGGAGGCCGCAG
AAGTTCAAGGCGATCTACCTGATGGCGACGCTGTACGTGCTGACGCTGACGCTGCCGTCG
GCGGCGAGCGTGTACTGGGCGTTCGGGGACGAGCTGCTCACGCACTCGAATGCGCTGGCG
CTGCTGCCGCGCACGGCGTTCCGGGACGCCGCCGTGGTGCTCATGCTCATCCACCAGTTC
ATCACCTTCGGCTTCGCCTGCACGCCGCTCTACTTCGTCTGGGAGAAGCTCATCGGACTC
CACGACTGCCGCAGCCTCTTCAAGCGCGCCGCCGCGAGGCTCCCCGTCGTCGTGCCCATC
TGGTTCCTCGCCATCATCTTCCCCTTCTTCGGGCCCATCAACTCCGCCGTCGGCTCCCTC
CTCGTCAGCTTCACCGTCTACATCATCCCCGCCCTCGCGCACATGATCACCTTCCGCTCC
GCGCACGCTCGTGAGAACGCCGTGGAGCCGCCGCCGCGGTTCGTGGGGCGATGGACGGGC
ACGTTCATCATCAACGCGTTCGTGGTGGCGTGGGTGCTGGTGGTCGGCTTCGGGTTCGGC
GGCTGGGCCAGCATGACCAACTTCGTCCGCCAGATCGACACGTTCGGGCTCTTCACCAAG
TGCTACCAGTGCccgccgccccctctgccgccggcgggcgccgctccgaacgccacctgg
ccgccgttcccggcgacgccgttcaacgccaccaccgccggcctcgctccggcccctgct
ccttcgccggcgcatttcttcggccgccaccaccggcatcacagccaCGGGCTCTGA

Protein

299 aa

>Os03t0244600-02 Similar to auxin transporter-like protein 3.
IVYSSVNTVIIDQTVKAVCDNITCDFGARREIMHAMWRPQKFKAIYLMATLYVLTLTLPS
AASVYWAFGDELLTHSNALALLPRTAFRDAAVVLMLIHQFITFGFACTPLYFVWEKLIGL
HDCRSLFKRAAARLPVVVPIWFLAIIFPFFGPINSAVGSLLVSFTVYIIPALAHMITFRS
AHARENAVEPPPRFVGRWTGTFIINAFVVAWVLVVGFGFGGWASMTNFVRQIDTFGLFTK
CYQCPPPPLPPAGAAPNATWPPFPATPFNATTAGLAPAPAPSPAHFFGRHHRHHSHGL*

5'UTR

chr03:7648591..7648591 (+ strand) : 1 bp

CDS

chr03:7648592..7649146 (+ strand) : 555 bp

chr03:7649910..7650251 (+ strand) : 342 bp

3'UTR

chr03:7650252..7650502 (+ strand) : 251 bp

FASTA

>Os03t0244600-02 class=Sequence position=chr03:7648591..7650502 (+ strand)
GATCGTTTAC AGCAGCGTCA ATACTGTAAT AATTGACCAA ACTGTCAAAG CAGTTTGTGA CAACATTACG TGTGATTTTG
GTGCGCGCAG GGAGATCATG CACGCGATGT GGAGGCCGCA GAAGTTCAAG GCGATCTACC TGATGGCGAC GCTGTACGTG
CTGACGCTGA CGCTGCCGTC GGCGGCGAGC GTGTACTGGG CGTTCGGGGA CGAGCTGCTC ACGCACTCGA ATGCGCTGGC
GCTGCTGCCG CGCACGGCGT TCCGGGACGC CGCCGTGGTG CTCATGCTCA TCCACCAGTT CATCACCTTC GGCTTCGCCT
GCACGCCGCT CTACTTCGTC TGGGAGAAGC TCATCGGACT CCACGACTGC CGCAGCCTCT TCAAGCGCGC CGCCGCGAGG
CTCCCCGTCG TCGTGCCCAT CTGGTTCCTC GCCATCATCT TCCCCTTCTT CGGGCCCATC AACTCCGCCG TCGGCTCCCT
CCTCGTCAGC TTCACCGTCT ACATCATCCC CGCCCTCGCG CACATGATCA CCTTCCGCTC CGCGCACGCT CGTGAGGTAT
AGTAAAAATC TTGGCATCTT TTTAATCACT GCGCTTTTTT TTTAACCTTT TGGTTTCACT TTTATCATGC GAGTTTACTA
GTGTAGGACT TGCATGTCGC ATTGCACTTT ACATTGGCAC GCCAAAGCTA GCTAGGTACT GATTAGATGC CACTTAGCAC
AGTGGTTATA CATTTATCAA GTGAGTTAGA CGAATGCTAG TTGGGTCCAC CCTTGTTCGG GATGGACTAT GGAAAGATGC
TGATACAAAA GGTAACCTTG GTTATGATCA AGGGTGAAAC ATCATTAGGG TGGTAAGTAT TGCCGCTGCT TTTGTCGTAC
TGAATGTAAG ACAAAACTGC GGCAGTGTTG ATCTGTCTTT TAACGTGGCA AGAAAAGCAA AAGGGTGCTA GTACCAAGCT
TAGAAGTAGA CTGTTGAGGA AAAACAGGAG ACAGAGGGCT CTTTTGTACC ATTCGTCCTG GTATATTTGG ACGAGCATCG
AACCACTCTC TTTGCAAGAC GACACAAAAA AGTTCAGTAC tactttctcc gtttcacaat ttaagtcatt ctagtatttt
ccacattcat attgatatta atgaatctag acatatatat gacttatatt ataAAACGGA GTGAGTAGCA AATTTAGAAG
TCATGTGATT TGTACTCAGT ACTACATTTT AATGGAGTAC AAGCTAGTAG CTGTGTGCTC TGTTGTTGTG ATGGTGTGAG
CCTGAACTGA GAATCCTTTG TCTGAATGCT AAACTGCAGA ACGCCGTGGA GCCGCCGCCG CGGTTCGTGG GGCGATGGAC
GGGCACGTTC ATCATCAACG CGTTCGTGGT GGCGTGGGTG CTGGTGGTCG GCTTCGGGTT CGGCGGCTGG GCCAGCATGA
CCAACTTCGT CCGCCAGATC GACACGTTCG GGCTCTTCAC CAAGTGCTAC CAGTGCccgc cgccccctct gccgccggcg
ggcgccgctc cgaacgccac ctggccgccg ttcccggcga cgccgttcaa cgccaccacc gccggcctcg ctccggcccc
tgctccttcg ccggcgcatt tcttcggccg ccaccaccgg catcacagcc aCGGGCTCTG AACACTGAAA TGTACGTACC
AGGGCAATGC TCGAGCTTTG GTTTAGCTAT AGTTGTTCAC TAGCGCCGTC ACTAATTAGT CTTAGCTTAG CACAAAGCTG
CATCTTCTCT AGCTATCAGT AGCATGTCAG TCAGACGGAG TATCCCGTTT CAAGTTCCTT GGTTCTGTAC TGCCTCCTGG
CGTGGAGCTC AAAAAACGAA CAGAAAAAAA GGGAATGTTG CTACGGCCGC AGATGCAAGA GCCAGCTAAT CT

Locus: Os03g0244600

Loading...

Locus: Os03g0244600

Loading...