Os03t0251350-01

Locus

Os03g0251350

Description

NUCLEAR FACTOR Y (NF-Y) transcription factor, Control of heading date

RAP-DB Gene Symbol Synonym(s)

OsHAP5C, OsNF-YC2

RAP-DB Gene Name Synonym(s)

Nuclear factor Y C2 subunit

CGSNL Gene Symbol

HAP5C

CGSNL Gene Name

HAP5C SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP5C, NF-YC, CBF-C, OsNF-YC2, Os-NF-YC2, NF-YC2, NFYC2, OsNF-YC4-1, NF-YC4-1

Oryzabase Gene Name Synonym(s)

Nuclear factor Y C2 subunit, Nuclear factor Y C subunit 2, NUCLEAR FACTOR-Y subunit C2, NUCLEAR FACTOR-Y subunit NF-YC2, NF-YC subunit 2, NF-YC family 2

Transcript Evidence

CT836539 (Guangluai4)

Protein Evidence

A6BLW4

Literature

PMID: 30107076

PMID: 26542958

Note

Manual Curation

January 25, 2019

Gene Ontology (GO)

Molecular Function: protein heterodimerization activity (GO:0046982)

Functional domain (InterPro)

Histone-fold (IPR009072)

Transcription factor CBF/NF-Y/archaeal histone domain (IPR003958)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Expression Databases

TENOR (Os03t0251350-00)

Others

Oryzabase (8493)

KEGG (Os03t0251350-00)

Transcript

1217 bp

>Os03t0251350-01 NUCLEAR FACTOR Y (NF-Y) transcription factor, Control of heading date
AACCCCAGTTGAGAGTGGAGATGGCCATTTTGTTCAGGCACTAGGCAGTGGGTAGGACGG
TGAGGAGTGTGTCCTGCACTCCTGCTTCCCCTGACGATCGATCCCCATGCGTGCCGAAGC
ATCTGATACTTTTGCTGTGCTGTTCTTTAATTTACCCTGATACTTTTGGATATCTGAAGC
AGTAGAGCTCGTTCACTCAAACAGGCTAGCCTGTTTTGCTTTCTGACACAGCACACACAG
CTACAAATCGACTGTAATTAAGGTACGTATATATAGGTGACAATGGACAACCAGCAGCTA
CCCTACGCCGGTCAGCCGGCGGCCGCAGGCGCCGGAGCCCCGGTGCCGGGCGTGCCTGGC
GCGGGCGGGCCGCCGGCGGTGCCGCACCACCACCTGCTCCAGCAGCAGCAGGCGCAGCTG
CAGGCGTTCTGGGCGTACCAGCGGCAGGAGGCGGAGCGCGCGTCGGCGTCGGACTTCAAG
AACCACCAGCTGCCGCTGGCGCGGATCAAGAAGATCATGAAGGCGGACGAGGACGTGCGC
ATGATCTCGGCGGAGGCGCCCGTGCTGTTCGCCAAGGCGTGCGAGCTCTTCATCCTGGAG
CTCACCATCCGCTCGTGGCTGCACGCCGAGGAGAACAAGCGCCGCACCCTGCAGCGCAAC
GACGTCGCCGCCGCCATCGCGCGCACCGACGTGTTCGACTTCCTCGTCGACATCGTGCCG
CGGGAGGAGGCCAAGGAGGAGCCCGGCAGCGCGCTCGGGTTCGCGGCGGGAGGGCCCGCC
GGCGCCGTTGGAGCGGCCGGCCCCGCCGCGGGGCTGCCGTACTACTACCCGCCGATGGGG
CAGCCGGCGCCGATGATGCCGGCGTGGCATGTTCCGGCGTGGGACCCGGCGTGGCAGCAA
GGAGCAGCGCCGGATGTGGACCAGGGCGCCGCCGGCAGCTTCAGCGAGGAAGGGCAGCAA
GGTTTTGCAGGCCATGGCGGTGCGGCAGCTAGCTTCCCTCCTGCACCTCCAAGCTCCGAA
TAGTGATGATCCATATGGTTCCATGCATGCATCGCTGAGGTGCTAGCTAGCTACTATAGC
TGCTCAAATCAAATGCTCAATGTGTCGGTAATTAATTAATGTGGTACGTATTAACTTAAC
CGATGTACGTAATGGACGCTCAAGCTAATTAAGGGATGTACAATTTACTAATTAATTTAA
TTTGTAATATATAGCCG

CDS

741 bp

>Os03t0251350-01 NUCLEAR FACTOR Y (NF-Y) transcription factor, Control of heading date
ATGGACAACCAGCAGCTACCCTACGCCGGTCAGCCGGCGGCCGCAGGCGCCGGAGCCCCG
GTGCCGGGCGTGCCTGGCGCGGGCGGGCCGCCGGCGGTGCCGCACCACCACCTGCTCCAG
CAGCAGCAGGCGCAGCTGCAGGCGTTCTGGGCGTACCAGCGGCAGGAGGCGGAGCGCGCG
TCGGCGTCGGACTTCAAGAACCACCAGCTGCCGCTGGCGCGGATCAAGAAGATCATGAAG
GCGGACGAGGACGTGCGCATGATCTCGGCGGAGGCGCCCGTGCTGTTCGCCAAGGCGTGC
GAGCTCTTCATCCTGGAGCTCACCATCCGCTCGTGGCTGCACGCCGAGGAGAACAAGCGC
CGCACCCTGCAGCGCAACGACGTCGCCGCCGCCATCGCGCGCACCGACGTGTTCGACTTC
CTCGTCGACATCGTGCCGCGGGAGGAGGCCAAGGAGGAGCCCGGCAGCGCGCTCGGGTTC
GCGGCGGGAGGGCCCGCCGGCGCCGTTGGAGCGGCCGGCCCCGCCGCGGGGCTGCCGTAC
TACTACCCGCCGATGGGGCAGCCGGCGCCGATGATGCCGGCGTGGCATGTTCCGGCGTGG
GACCCGGCGTGGCAGCAAGGAGCAGCGCCGGATGTGGACCAGGGCGCCGCCGGCAGCTTC
AGCGAGGAAGGGCAGCAAGGTTTTGCAGGCCATGGCGGTGCGGCAGCTAGCTTCCCTCCT
GCACCTCCAAGCTCCGAATAG

Protein

247 aa

>Os03t0251350-01 NUCLEAR FACTOR Y (NF-Y) transcription factor, Control of heading date
MDNQQLPYAGQPAAAGAGAPVPGVPGAGGPPAVPHHHLLQQQQAQLQAFWAYQRQEAERA
SASDFKNHQLPLARIKKIMKADEDVRMISAEAPVLFAKACELFILELTIRSWLHAEENKR
RTLQRNDVAAAIARTDVFDFLVDIVPREEAKEEPGSALGFAAGGPAGAVGAAGPAAGLPY
YYPPMGQPAPMMPAWHVPAWDPAWQQGAAPDVDQGAAGSFSEEGQQGFAGHGGAAASFPP
APPSSE*

5'UTR

chr03:7979147..7979371 (- strand) : 225 bp

chr03:7977930..7977986 (- strand) : 57 bp

CDS

chr03:7977189..7977929 (- strand) : 741 bp

3'UTR

chr03:7976995..7977188 (- strand) : 194 bp

FASTA

>Os03t0251350-01 class=Sequence position=chr03:7976995..7979371 (- strand)
AACCCCAGTT GAGAGTGGAG ATGGCCATTT TGTTCAGGCA CTAGGCAGTG GGTAGGACGG TGAGGAGTGT GTCCTGCACT
CCTGCTTCCC CTGACGATCG ATCCCCATGC GTGCCGAAGC ATCTGATACT TTTGCTGTGC TGTTCTTTAA TTTACCCTGA
TACTTTTGGA TATCTGAAGC AGTAGAGCTC GTTCACTCAA ACAGGCTAGC CTGTTTTGCT TTCTGGTAAG AACTTAATTA
ACTAGTTGAG ATCGACATGC ATGGATGCGT GAATCTATTG TTGCATTTTT TCTAATGGAT AGTTAGATTT GTTCCAGCTT
TTTTTTTGTC AATTCTGTTA CATTTGCAGT GTCTTCAACT TCTGCATCAT TCTTCTCTAT TCTTCCTTCA CTTTCTTTCT
TGAACTAGAA AAGCAAACCA GAGTTCTTTT TCCCCCTCTT CTACATAAAC GAAAACAGCT TGTTGACTGG CTCCCTAGAG
CTTTTTGTAA GTTGATCATC GAAGTAGCTA GTTCTCTTCA CTTATCAGTC ATCACTGTTC TATGTTCTAT CTGCATTTTC
CTTGATTTTG TACTTTTCCT GAACGAAAGG ACAATCCTTA GCCATCATAA TGCTATGATC GACTTATTCT GAAGTCATCC
GGCCTCGATC CTCTTTTGTT TCGGTGAGAT CTGTAATGGT TTAGGAAAAT TATGGATCTC TGAAAAATAA GAAACATCTA
GTAGTATATG AAATTAAGAA ATGTCGGACC ACGTCAAATC CTACTGGTAT CATATACCAG ATAACTAACt ttttgaatgg
aaccaaacac gagattgtga atatatagca gtaagaaata caaccccgaa gggtaaagga gaaaaaggaa aagcagttta
gtgtacgagc tgtaggagta gctttgctcc tgccaaggcc cagatccttg cctcttcctt catttctgcg aggagaccag
gcactgaggt ctcattgtga tcgaagattc tcctgtttct ctccttccag atctccTTTG GGAACACCCT GTGTGTTTGC
AAGCGCTTAG CTTCATTTTC ATGCATGATA TGATCTCTGG ATAGAAGATA AGTAGCCCCC ACACATGCAC TTCGCCACCT
ATAGCCAGCC TCGAGTTCTC ATCTGTTTGA TCCGTCGCAC ATGTGGAGCA ACGAAGCTCT AGAGTACGTC TCCTAATCTC
TACTTACTTT TGCAGTTTGC ACACATATTG AGAAATGCTT ATCAATCCTT CGATCTCTCA CAGACAATAC CTACAAGCGT
CGTTTACACT TTGCATGTAT AGCTAGCCAT TGTTACATAC GTGGAGCATG TAGCGATCAT TCGTTCCTAG CACGTAAATT
AATCGCCGTA ATTTTGCCCA TGCAGACACA GCACACACAG CTACAAATCG ACTGTAATTA AGGTACGTAT ATATAGGTGA
CAATGGACAA CCAGCAGCTA CCCTACGCCG GTCAGCCGGC GGCCGCAGGC GCCGGAGCCC CGGTGCCGGG CGTGCCTGGC
GCGGGCGGGC CGCCGGCGGT GCCGCACCAC CACCTGCTCC AGCAGCAGCA GGCGCAGCTG CAGGCGTTCT GGGCGTACCA
GCGGCAGGAG GCGGAGCGCG CGTCGGCGTC GGACTTCAAG AACCACCAGC TGCCGCTGGC GCGGATCAAG AAGATCATGA
AGGCGGACGA GGACGTGCGC ATGATCTCGG CGGAGGCGCC CGTGCTGTTC GCCAAGGCGT GCGAGCTCTT CATCCTGGAG
CTCACCATCC GCTCGTGGCT GCACGCCGAG GAGAACAAGC GCCGCACCCT GCAGCGCAAC GACGTCGCCG CCGCCATCGC
GCGCACCGAC GTGTTCGACT TCCTCGTCGA CATCGTGCCG CGGGAGGAGG CCAAGGAGGA GCCCGGCAGC GCGCTCGGGT
TCGCGGCGGG AGGGCCCGCC GGCGCCGTTG GAGCGGCCGG CCCCGCCGCG GGGCTGCCGT ACTACTACCC GCCGATGGGG
CAGCCGGCGC CGATGATGCC GGCGTGGCAT GTTCCGGCGT GGGACCCGGC GTGGCAGCAA GGAGCAGCGC CGGATGTGGA
CCAGGGCGCC GCCGGCAGCT TCAGCGAGGA AGGGCAGCAA GGTTTTGCAG GCCATGGCGG TGCGGCAGCT AGCTTCCCTC
CTGCACCTCC AAGCTCCGAA TAGTGATGAT CCATATGGTT CCATGCATGC ATCGCTGAGG TGCTAGCTAG CTACTATAGC
TGCTCAAATC AAATGCTCAA TGTGTCGGTA ATTAATTAAT GTGGTACGTA TTAACTTAAC CGATGTACGT AATGGACGCT
CAAGCTAATT AAGGGATGTA CAATTTACTA ATTAATTTAA TTTGTAATAT ATAGCCG

Locus: Os03g0251350

Loading...

Locus: Os03g0251350

Loading...