Os03t0247600-02

Locus

Os03g0247600

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK059508 (DDBJ, Best hit)

Protein Evidence

B8AK18 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-029-B01 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0247600-02)

Others

KEGG (Os03t0247600-02)

Transcript

979 bp

>Os03t0247600-02 Hypothetical conserved gene.
AAACAATGCAGGATTGAGGTGGAGAACTGCTTCTCCCTCTCTGAAAATACAGGGTCCATG
GTGGACATGATCAATGTCGCGGCACGATGTGCCTTTTTACTTTGTGCAAGTGAGATTTCA
TATGATGTTGGAGAACGCTACAATTTCGCGAGCATTCTGCTTCATTTCAGATACACCTGT
TGCTCACTGCACAAACTCCTGGATATGGATATCCATGTGAGGTCATCAGAGTAGCAAGTT
GATGGATCATCGCCATGATGCTATTGCTGCATACGGAAGATGACCTGATTTATCTATAAA
TGATGCAGTGGTGCTGATGACCAATGCCATCTCTGCATCAGTCAGGTCCAAGTGAAAGCG
AAAAAAAGGCTTTTCAGAAGACAAGATCAAGTGACTGGACGGTCACAATGAGAGCAAACT
CGGGACTTATCTTTGCCGTGATGATCCTGATAATGTGTGGCGCATCTGCAGCTTCCAGTG
ACAATGATGAGCTGGTGGCACCGTTCGACACATCCAATGGCCTGAGAACGCTGTGAACGG
CCACTTGGGCTGCTACCCCGGGTGCTTCAGAGACTGTGTTACAAGGATGCCTGAATGCTG
TTCTGTGAGGAAATTTGCTGTCAGCATGGCCGATCTCCTTCGGTTCACGCATCAGTAATT
CATCTATTTGCGTTCAGATAACGTTGTGACCATTTCTTTCAGTAGCAGTAGCTTGCGTCG
CTCTCCGCATGAGTAATCTTAAGTCTTTGGCAATTCACTGTAATATATACTAATATGCTC
TTCCGCGGGGTCCCCCATTTTAATTCTTCAAGCCGGCGAGGTGTGTAATAGATTGGGATG
GCCTATGGCCGTGATCTAAGGGCAGTTGATGTTTGTGAATTCAGACTGTTCCTGTCGATG
TCATGGAACGCATTGTGGACTTGTGCTTGGTTGTATGAGGTGATGTTTGATTCACTAGCA
GTCACTGTTGGTTAGATGC

CDS

213 bp

>Os03t0247600-02 Hypothetical conserved gene.
ATGCCATCTCTGCATCAGTCAGGTCCAAGTGAAAGCGAAAAAAAGGCTTTTCAGAAGACA
AGATCAAGTGACTGGACGGTCACAATGAGAGCAAACTCGGGACTTATCTTTGCCGTGATG
ATCCTGATAATGTGTGGCGCATCTGCAGCTTCCAGTGACAATGATGAGCTGGTGGCACCG
TTCGACACATCCAATGGCCTGAGAACGCTGTGA

Protein

71 aa

>Os03t0247600-02 Hypothetical conserved gene.
MPSLHQSGPSESEKKAFQKTRSSDWTVTMRANSGLIFAVMILIMCGASAASSDNDELVAP
FDTSNGLRTL*

5'UTR

chr03:7800372..7800572 (+ strand) : 201 bp

chr03:7801085..7801206 (+ strand) : 122 bp

CDS

chr03:7801207..7801419 (+ strand) : 213 bp

3'UTR

chr03:7801420..7801862 (+ strand) : 443 bp

FASTA

>Os03t0247600-02 class=Sequence position=chr03:7800372..7801862 (+ strand)
AAACAATGCA GGATTGAGGT GGAGAACTGC TTCTCCCTCT CTGAAAATAC AGGGTCCATG GTGGACATGA TCAATGTCGC
GGCACGATGT GCCTTTTTAC TTTGTGCAAG TGAGATTTCA TATGATGTTG GAGAACGCTA CAATTTCGCG AGCATTCTGC
TTCATTTCAG ATACACCTGT TGCTCACTGC ACAAACTCCT GGTAATTCCC ATGGCATCTG ATGTGTTAGT AGTGTGGTAT
GATGCTTCAT GAATTTATAC TAGTACTAAT GTGCTAGTGT TAGTTATAGA ATGTTTATTC ATCACCCGGT TCTTTCCAGA
AAATATTGTA CAGCTTATAC CCAATCTTAT GGCTTGTTTT CATCTGGAGT GCTCAAGCCT CAAGGGACAT ACATGTATTA
CTGCTACTAC CACCACTTAA CAAGTTACAT ACTCATTTTC ATCTGAATCA CAATTCTAAT ACTTGTTTCT TATGCCCAGT
CAACACTAAC TTAAACCAGT TACCAGACTG AACATTAGAT AACAAATGTC CCAGCTCCCT TATCATACTA GTGGTTAATC
TCTCACACGT CATATTAACT TAGAAAGATG CTTTAAATGA TAACCAAGTA TTACAACTGG TGCCTGATAC TCTGATAGAA
ACCTTTGTTA CATTCTAGGA CTCGGATAAA TGACATCATC TATTATCAAC AAGGGATAAC TCTTCTGTAG TAGGATATGG
ATATCCATGT GAGGTCATCA GAGTAGCAAG TTGATGGATC ATCGCCATGA TGCTATTGCT GCATACGGAA GATGACCTGA
TTTATCTATA AATGATGCAG TGGTGCTGAT GACCAATGCC ATCTCTGCAT CAGTCAGGTC CAAGTGAAAG CGAAAAAAAG
GCTTTTCAGA AGACAAGATC AAGTGACTGG ACGGTCACAA TGAGAGCAAA CTCGGGACTT ATCTTTGCCG TGATGATCCT
GATAATGTGT GGCGCATCTG CAGCTTCCAG TGACAATGAT GAGCTGGTGG CACCGTTCGA CACATCCAAT GGCCTGAGAA
CGCTGTGAAC GGCCACTTGG GCTGCTACCC CGGGTGCTTC AGAGACTGTG TTACAAGGAT GCCTGAATGC TGTTCTGTGA
GGAAATTTGC TGTCAGCATG GCCGATCTCC TTCGGTTCAC GCATCAGTAA TTCATCTATT TGCGTTCAGA TAACGTTGTG
ACCATTTCTT TCAGTAGCAG TAGCTTGCGT CGCTCTCCGC ATGAGTAATC TTAAGTCTTT GGCAATTCAC TGTAATATAT
ACTAATATGC TCTTCCGCGG GGTCCCCCAT TTTAATTCTT CAAGCCGGCG AGGTGTGTAA TAGATTGGGA TGGCCTATGG
CCGTGATCTA AGGGCAGTTG ATGTTTGTGA ATTCAGACTG TTCCTGTCGA TGTCATGGAA CGCATTGTGG ACTTGTGCTT
GGTTGTATGA GGTGATGTTT GATTCACTAG CAGTCACTGT TGGTTAGATG C

Locus: Os03g0247600

Loading...

Locus: Os03g0247600

Loading...