Os03t0249500-01

Locus

Os03g0249500

Description

Similar to Nucleotide sugar epimerase-like protein (UDP-D-glucuronate 4- epimerase) (EC 5.1.3.6).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsUGlcAE1

Oryzabase Gene Name Synonym(s)

UDP-glucuronic acid 4-epimerase 1

Transcript Evidence

AK121154 (DDBJ, Best hit)

Protein Evidence

NP_182056.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Biological Process: cellular metabolic process (GO:0044237)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: racemase and epimerase activity, acting on carbohydrates and derivatives (GO:0016857)

Molecular Function: coenzyme binding (GO:0050662)

Functional domain (InterPro)

NAD-dependent epimerase/dehydratase (IPR001509)

Nucleotide sugar epimerase (IPR008089)

NAD(P)-binding domain (IPR016040)

Full-length cDNA

J023078O05 (Online Clone Ordering)

Expression Databases

TENOR (Os03t0249500-01)

RiceXPro (AK121154)

Others

Oryzabase (15782)

KEGG (Os03t0249500-01 (EC:5.1.3.6))

Transcript

1955 bp

>Os03t0249500-01 Similar to Nucleotide sugar epimerase-like protein (UDP-D-glucuronate 4- epimerase) (EC 5.1.3.6).
AACCCCACCCAAATTCGCGAGATCCGACGAGGAGCTCAATCCACATTGCGGCAGATCGGG
AGATGGCGCCGCAGCTGACCGGCGCGCCCGGCACGGCGGGGGCGGCGGGCGGCGCGGCGT
CCGTCAAGCCGCAGTTCCACCACTTCCACCACCACCGCCTCGCCACGCGCCACCACCACC
CCTCGCCGACCTCGCTCCTCTCCAAGCTCGCCTTCTGGTCCGTCTGCTCCCTCTCGCTCC
TCCTCGCCTTCCTCCTCCTCTCCCCCTCCGCCGCGCCGGCCCCGCGGGCGGCGCCCGACT
CCCCGCGCCGCTCCCTCCACACGTCCTCCCcgtccgccgccgccacgtggggcggcgccg
catgggagaagaaggtgcgggcgtccgcgcgcgtcaggcgggccaacgggcgggggctca
ccgtcctcgtcacgggcgccgcgggcttcgtcggctgccacgcggccgccgccctccgcc
gccgcggcgacggCGTGCTTGGGCTGGACAACTTCAACGACTACTACGACCCCGCCCTCA
AGCGGGGCCGCGCCGCGCTCCTCGCCCGCTCGGGGGTCTACGTCGTCGACGGCGACATCG
CCGATGCGGAGCTCCTCGCCAAGCTGTTCGACGTCGTGCCGTTCACCCACGTCCTCCACC
TCGCCGCTCAGGCGGGCGTTCGGCACGCGCTCGTTGACCCGATGTCCTACGTGCGCGCCA
ACGTCGGCGGGTTCGTGGCGCTGCTCGAGGCGGCGCGCATGGCGAATCCCCAGCCGGCGA
TCGTCTGGGCGTCGTCGTCTTCAGTGTACGGGCTCAACTCCCATGTGCCTTTCTCCGAAC
ATGACAGGACGGACCGACCCGCCTCTCTGTATGCAGCGACCAAGAAGGCCGGTGAGGAGA
TCGCTCATGCCTACAACCACATCTATGGGCTCTCGCTCACGGCGCTCCGTTTCTTCACCG
TGTATGGGCCGTGGGGGCGCCCAGACATGGCATACTTCTTCTTCACCCGGGACATTCTTG
CTGGTCGGCCAATCACCGTGTATGAAAGTGCAGGTGGAGGCACACACCAGACCACCATTT
CCCGAGATTTCACCTATATTGATGACATTGTGAAGGGGTGTGTTGGGGCATTGGATACAG
CCGGGCGTAGCACAGGCAGTGGAGGCAAGAAGCGAGGGCCGGCACCATTCAGGACATACA
ATTTGGGGAACACATCTCCTGTGCCGGTGACACAGCTGGTGGATTTACTGGAGAAGTTGC
TCAAGGTGAAAGCGGTGAGGAAGATTGTCAAGATGCCAAGGAATGGTGATGTGCCATATA
CACATGCTAACATCAGTCTTGCTCAGCGGGAGCTTGGGTACCGACCGTCAACTGATCTTC
AAACAGGGGTTAAGAAGTTTGTGCGGTGGTATCTCGAGTACTACATGCCTGGGTTTGCTG
GTAAGCAGAAGCAGCATGGCAGTAGCAACAGCAAGTCTTCGCGAGGTCGGAGTGGCAACA
CAAGCAGTGCAAGATGATTGGATATTCATTTTCTTCATGGCCTTCTTCTGACGGTGTGTA
TCATTGTTCTAGATCCAGTGCTTAACTCATCAGGTCTGAGAGGCTCGTTTTGCTCAGCAC
GTCCTTCAAGTGAAACAAAACGATCATTAATTAGCTTGTATTGAAAAAACCCTTCCACTC
TATTGGCTTCCCCATAGCTGAGCGTTCAAATCCTAGTTCCATTAGCTGGTTCTTAGGATG
ACAATTGTAGGAAGAACTGGGTTGGGTTCTGGGGCAGGCTGTGAGTTGCAAAGACTATAA
TAGATTCTTTTAGTGACATTTTGTACCACGGGAGAGAAGGAAGTACACCATGACTGTTTC
GTTTGTTCAATTGAAATAGCTCTGATCAACCTGCTATCTCTCTGTACTTTGCATTGTCAT
GTTACTTTTATAGATGCTCGGTCTGTATTTACTGC

CDS

1455 bp

>Os03t0249500-01 Similar to Nucleotide sugar epimerase-like protein (UDP-D-glucuronate 4- epimerase) (EC 5.1.3.6).
ATGGCGCCGCAGCTGACCGGCGCGCCCGGCACGGCGGGGGCGGCGGGCGGCGCGGCGTCC
GTCAAGCCGCAGTTCCACCACTTCCACCACCACCGCCTCGCCACGCGCCACCACCACCCC
TCGCCGACCTCGCTCCTCTCCAAGCTCGCCTTCTGGTCCGTCTGCTCCCTCTCGCTCCTC
CTCGCCTTCCTCCTCCTCTCCCCCTCCGCCGCGCCGGCCCCGCGGGCGGCGCCCGACTCC
CCGCGCCGCTCCCTCCACACGTCCTCCCcgtccgccgccgccacgtggggcggcgccgca
tgggagaagaaggtgcgggcgtccgcgcgcgtcaggcgggccaacgggcgggggctcacc
gtcctcgtcacgggcgccgcgggcttcgtcggctgccacgcggccgccgccctccgccgc
cgcggcgacggCGTGCTTGGGCTGGACAACTTCAACGACTACTACGACCCCGCCCTCAAG
CGGGGCCGCGCCGCGCTCCTCGCCCGCTCGGGGGTCTACGTCGTCGACGGCGACATCGCC
GATGCGGAGCTCCTCGCCAAGCTGTTCGACGTCGTGCCGTTCACCCACGTCCTCCACCTC
GCCGCTCAGGCGGGCGTTCGGCACGCGCTCGTTGACCCGATGTCCTACGTGCGCGCCAAC
GTCGGCGGGTTCGTGGCGCTGCTCGAGGCGGCGCGCATGGCGAATCCCCAGCCGGCGATC
GTCTGGGCGTCGTCGTCTTCAGTGTACGGGCTCAACTCCCATGTGCCTTTCTCCGAACAT
GACAGGACGGACCGACCCGCCTCTCTGTATGCAGCGACCAAGAAGGCCGGTGAGGAGATC
GCTCATGCCTACAACCACATCTATGGGCTCTCGCTCACGGCGCTCCGTTTCTTCACCGTG
TATGGGCCGTGGGGGCGCCCAGACATGGCATACTTCTTCTTCACCCGGGACATTCTTGCT
GGTCGGCCAATCACCGTGTATGAAAGTGCAGGTGGAGGCACACACCAGACCACCATTTCC
CGAGATTTCACCTATATTGATGACATTGTGAAGGGGTGTGTTGGGGCATTGGATACAGCC
GGGCGTAGCACAGGCAGTGGAGGCAAGAAGCGAGGGCCGGCACCATTCAGGACATACAAT
TTGGGGAACACATCTCCTGTGCCGGTGACACAGCTGGTGGATTTACTGGAGAAGTTGCTC
AAGGTGAAAGCGGTGAGGAAGATTGTCAAGATGCCAAGGAATGGTGATGTGCCATATACA
CATGCTAACATCAGTCTTGCTCAGCGGGAGCTTGGGTACCGACCGTCAACTGATCTTCAA
ACAGGGGTTAAGAAGTTTGTGCGGTGGTATCTCGAGTACTACATGCCTGGGTTTGCTGGT
AAGCAGAAGCAGCATGGCAGTAGCAACAGCAAGTCTTCGCGAGGTCGGAGTGGCAACACA
AGCAGTGCAAGATGA

Protein

484 aa

>Os03t0249500-01 Similar to Nucleotide sugar epimerase-like protein (UDP-D-glucuronate 4- epimerase) (EC 5.1.3.6).
MAPQLTGAPGTAGAAGGAASVKPQFHHFHHHRLATRHHHPSPTSLLSKLAFWSVCSLSLL
LAFLLLSPSAAPAPRAAPDSPRRSLHTSSPSAAATWGGAAWEKKVRASARVRRANGRGLT
VLVTGAAGFVGCHAAAALRRRGDGVLGLDNFNDYYDPALKRGRAALLARSGVYVVDGDIA
DAELLAKLFDVVPFTHVLHLAAQAGVRHALVDPMSYVRANVGGFVALLEAARMANPQPAI
VWASSSSVYGLNSHVPFSEHDRTDRPASLYAATKKAGEEIAHAYNHIYGLSLTALRFFTV
YGPWGRPDMAYFFFTRDILAGRPITVYESAGGGTHQTTISRDFTYIDDIVKGCVGALDTA
GRSTGSGGKKRGPAPFRTYNLGNTSPVPVTQLVDLLEKLLKVKAVRKIVKMPRNGDVPYT
HANISLAQRELGYRPSTDLQTGVKKFVRWYLEYYMPGFAGKQKQHGSSNSKSSRGRSGNT
SSAR*

5'UTR

chr03:7889338..7889399 (+ strand) : 62 bp

CDS

chr03:7889400..7890854 (+ strand) : 1455 bp

3'UTR

chr03:7890855..7891292 (+ strand) : 438 bp

FASTA

>Os03t0249500-01 class=Sequence position=chr03:7889338..7891292 (+ strand)
AACCCCACCC AAATTCGCGA GATCCGACGA GGAGCTCAAT CCACATTGCG GCAGATCGGG AGATGGCGCC GCAGCTGACC
GGCGCGCCCG GCACGGCGGG GGCGGCGGGC GGCGCGGCGT CCGTCAAGCC GCAGTTCCAC CACTTCCACC ACCACCGCCT
CGCCACGCGC CACCACCACC CCTCGCCGAC CTCGCTCCTC TCCAAGCTCG CCTTCTGGTC CGTCTGCTCC CTCTCGCTCC
TCCTCGCCTT CCTCCTCCTC TCCCCCTCCG CCGCGCCGGC CCCGCGGGCG GCGCCCGACT CCCCGCGCCG CTCCCTCCAC
ACGTCCTCCC cgtccgccgc cgccacgtgg ggcggcgccg catgggagaa gaaggtgcgg gcgtccgcgc gcgtcaggcg
ggccaacggg cgggggctca ccgtcctcgt cacgggcgcc gcgggcttcg tcggctgcca cgcggccgcc gccctccgcc
gccgcggcga cggCGTGCTT GGGCTGGACA ACTTCAACGA CTACTACGAC CCCGCCCTCA AGCGGGGCCG CGCCGCGCTC
CTCGCCCGCT CGGGGGTCTA CGTCGTCGAC GGCGACATCG CCGATGCGGA GCTCCTCGCC AAGCTGTTCG ACGTCGTGCC
GTTCACCCAC GTCCTCCACC TCGCCGCTCA GGCGGGCGTT CGGCACGCGC TCGTTGACCC GATGTCCTAC GTGCGCGCCA
ACGTCGGCGG GTTCGTGGCG CTGCTCGAGG CGGCGCGCAT GGCGAATCCC CAGCCGGCGA TCGTCTGGGC GTCGTCGTCT
TCAGTGTACG GGCTCAACTC CCATGTGCCT TTCTCCGAAC ATGACAGGAC GGACCGACCC GCCTCTCTGT ATGCAGCGAC
CAAGAAGGCC GGTGAGGAGA TCGCTCATGC CTACAACCAC ATCTATGGGC TCTCGCTCAC GGCGCTCCGT TTCTTCACCG
TGTATGGGCC GTGGGGGCGC CCAGACATGG CATACTTCTT CTTCACCCGG GACATTCTTG CTGGTCGGCC AATCACCGTG
TATGAAAGTG CAGGTGGAGG CACACACCAG ACCACCATTT CCCGAGATTT CACCTATATT GATGACATTG TGAAGGGGTG
TGTTGGGGCA TTGGATACAG CCGGGCGTAG CACAGGCAGT GGAGGCAAGA AGCGAGGGCC GGCACCATTC AGGACATACA
ATTTGGGGAA CACATCTCCT GTGCCGGTGA CACAGCTGGT GGATTTACTG GAGAAGTTGC TCAAGGTGAA AGCGGTGAGG
AAGATTGTCA AGATGCCAAG GAATGGTGAT GTGCCATATA CACATGCTAA CATCAGTCTT GCTCAGCGGG AGCTTGGGTA
CCGACCGTCA ACTGATCTTC AAACAGGGGT TAAGAAGTTT GTGCGGTGGT ATCTCGAGTA CTACATGCCT GGGTTTGCTG
GTAAGCAGAA GCAGCATGGC AGTAGCAACA GCAAGTCTTC GCGAGGTCGG AGTGGCAACA CAAGCAGTGC AAGATGATTG
GATATTCATT TTCTTCATGG CCTTCTTCTG ACGGTGTGTA TCATTGTTCT AGATCCAGTG CTTAACTCAT CAGGTCTGAG
AGGCTCGTTT TGCTCAGCAC GTCCTTCAAG TGAAACAAAA CGATCATTAA TTAGCTTGTA TTGAAAAAAC CCTTCCACTC
TATTGGCTTC CCCATAGCTG AGCGTTCAAA TCCTAGTTCC ATTAGCTGGT TCTTAGGATG ACAATTGTAG GAAGAACTGG
GTTGGGTTCT GGGGCAGGCT GTGAGTTGCA AAGACTATAA TAGATTCTTT TAGTGACATT TTGTACCACG GGAGAGAAGG
AAGTACACCA TGACTGTTTC GTTTGTTCAA TTGAAATAGC TCTGATCAAC CTGCTATCTC TCTGTACTTT GCATTGTCAT
GTTACTTTTA TAGATGCTCG GTCTGTATTT ACTGC

Locus: Os03g0249500

Loading...

Locus: Os03g0249500

Loading...