Os03t0254400-01

Locus

Os03g0254400

Description

Patatin-related phospholipase A, Modulation of longitudinal growth of vegetative tissues and seeds

RAP-DB Gene Symbol Synonym(s)

OspPLAIIIalpha, pPLAIIIalpha

RAP-DB Gene Name Synonym(s)

Patatin-related phospholipase A III alpha

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OspPLAIIIalpha, pPLAIIIalpha

Oryzabase Gene Name Synonym(s)

Patatin-related phospholipase A III alpha

Transcript Evidence

XM_015772654

Protein Evidence

Q10NY5

Literature

PMID: 26290597

Note

Manual Curation

June 3, 2016

Gene Ontology (GO)

Biological Process: lipid metabolic process (GO:0006629)

Biological Process: metabolic process (GO:0008152)

Functional domain (InterPro)

Acyl transferase/acyl hydrolase/lysophospholipase (IPR016035)

Patatin/Phospholipase A2-related (IPR002641)

Others

Oryzabase (19872)

Transcript

2108 bp

>Os03t0254400-01 Patatin-related phospholipase A, Modulation of longitudinal growth of vegetative tissues and seeds
CAAAGGAGAGAGAGAGAGAGAGAGGAAGACGACGACGACCTTTGTTGTTGTTTCCTTCTT
TCTCTTCTCTTCTCCTCATCCTCCTCTTTAGCTTCCTCTCGCGCTCGCCGTCTCTCTCTC
TCTCTCTCTATCGGGCGCGCGCCTTTCTGTGTTGGTCGTCTCTTTCCTCGCGTGCTCTGC
CGCTGCGCAAGAATCAAAAGGCGCCGGCCACTAGAGAGAGTGTGTGTTTGTGTGTGTGTG
GCTTGAGTTGAGAGTTGAGAGACCAATCGACCATCGGCTGTGATCTCAAAAGAGAGAGAG
GGGCAAAGCGAAGTGGGCAGACTTGGGCGGCAATCCTTGCGAATCATCAAGGGATTCTGT
CTTTTCTTTGGTGCGATTCGATTGTTTCTTTGTAGGGGGAAGGGAGAGAGGAGGGGGGGG
GGGGGTTTTGGCAATTGGCATGGAGGAGGCGGAGGAGATGCAGGTGGAGAGGATGCAGGA
GGAGGTGGAGGGAGGCGGCGCGGATACGGATAAGCTCAGCTACGAGATTTTCTCCATCCT
CGAGAGCAAGTTCCTGTTCGGGTACACGGACCCGCACCAGCTGTGGCTGCCCAAGGCGCC
GGCGGCGCAGGCGTCGGCGGCGACGGCCGTGCCGTCGGGGAAGGCGGCGCAGCGTGGGAA
GGTGTGCGTGCTGTGCGTGGATGGCGGCGGCGGCGGGCTGCGGGCGCTGCTCTCCGGCCg
cgcgctggcgcacctggaggccgcgctccggcgcgcgtcgggcgacccggacgcccgcgt
cgcggactacttcgacctcgtcgccggtacgggcgccggcggcgtgttcgccgcgatgct
gttctcgacgcactcgcgcggcgcgcctctgttccacgccgatgacacatggcgcctcgt
ggctgaccacgctccccggctcttccgcaaggccgtcggcggctcgacgtcgctcttctg
ccgacccaagaagcggcccctcgcggcgccgacggcggcgctggacgcggccatgaagac
ggcgttcggcgaggagctcACCCTGCGGGATACCATCAAGCCCGTGCTCATCTCCTGCTA
CGACCTCAAGTCGTCCGCGCCGCTCGTGTTCTCGCGCGCCGACGCCCTggagagcgagag
ctacgacttccgcctctgcgaggtcggccgcgcggcgtggtcggaggccggccgattcga
gcccgccgaggtcgcgtcggtcgacggcgccacgtcctgcgccgccgtggacggcgggcc
gatcatgggcagccccgccgccgccgcaatcacgcacgtgcttcacaacaagcacgagtt
cccgttcgtgcgcggcgtcgaggacctcctCGTGCTCTCCATCGGGGGATGCTCCGCCGG
TGGCACGGGGGccgcggccgacgccgacctccgacgcttgcgccgctggggtcccaagga
ttgggcgcgccccatcgcgcgcatcgccgccgacggcgccgccgacctcgtcgaccacgc
cgtggcgcgcgccttcgggcagtgccgctcgtccAACTACCTGCGCATTCAGGCGAAACG
GGAGAGCATGCCGCCGTGCGGGCCGGACGGGGAGTACGACCCAACCCCGGCGAACGTGCA
CGCGCTGCTCGCGGCGGCGGACGAGATGCTGAAGCACCGGAACGTGGAGTCGGTGCTGTT
CGAAGGGAGGCGTGTCGGCGAGCAGACGAACGCGGAGAGGCTGGACTGCTTcgccgccga
gctcgtcgccgagcatcgcagcaggggctcccgtattggccccaccgtggcgttcaagca
ggcgccgcggaagcagccgccggcggcggcggtggcggcgatgggctgagccggtggccg
cgtgcacTGTGGAGTAAGGACATGTAGGCCCTCTCTTTCTTCTTGCTTTCGCTGGAATCC
TGCTGCATTTTTTACGTGGCAGAGTGGCATTGCTCCAAGAAGCATTTTGCCAATGGGAAA
TTCGACTTGGAGAAAATATGAAAGAACATCTGTGATATATAATTTCAGCTTCATTTCAAT
TTAGCATAGAATTGTACTAGTATCATCTTTCTTCAGAATCATATGCTTCTTTGTTTTCTC
TTCACATA

CDS

1410 bp

>Os03t0254400-01 Patatin-related phospholipase A, Modulation of longitudinal growth of vegetative tissues and seeds
ATGGAGGAGGCGGAGGAGATGCAGGTGGAGAGGATGCAGGAGGAGGTGGAGGGAGGCGGC
GCGGATACGGATAAGCTCAGCTACGAGATTTTCTCCATCCTCGAGAGCAAGTTCCTGTTC
GGGTACACGGACCCGCACCAGCTGTGGCTGCCCAAGGCGCCGGCGGCGCAGGCGTCGGCG
GCGACGGCCGTGCCGTCGGGGAAGGCGGCGCAGCGTGGGAAGGTGTGCGTGCTGTGCGTG
GATGGCGGCGGCGGCGGGCTGCGGGCGCTGCTCTCCGGCCgcgcgctggcgcacctggag
gccgcgctccggcgcgcgtcgggcgacccggacgcccgcgtcgcggactacttcgacctc
gtcgccggtacgggcgccggcggcgtgttcgccgcgatgctgttctcgacgcactcgcgc
ggcgcgcctctgttccacgccgatgacacatggcgcctcgtggctgaccacgctccccgg
ctcttccgcaaggccgtcggcggctcgacgtcgctcttctgccgacccaagaagcggccc
ctcgcggcgccgacggcggcgctggacgcggccatgaagacggcgttcggcgaggagctc
ACCCTGCGGGATACCATCAAGCCCGTGCTCATCTCCTGCTACGACCTCAAGTCGTCCGCG
CCGCTCGTGTTCTCGCGCGCCGACGCCCTggagagcgagagctacgacttccgcctctgc
gaggtcggccgcgcggcgtggtcggaggccggccgattcgagcccgccgaggtcgcgtcg
gtcgacggcgccacgtcctgcgccgccgtggacggcgggccgatcatgggcagccccgcc
gccgccgcaatcacgcacgtgcttcacaacaagcacgagttcccgttcgtgcgcggcgtc
gaggacctcctCGTGCTCTCCATCGGGGGATGCTCCGCCGGTGGCACGGGGGccgcggcc
gacgccgacctccgacgcttgcgccgctggggtcccaaggattgggcgcgccccatcgcg
cgcatcgccgccgacggcgccgccgacctcgtcgaccacgccgtggcgcgcgccttcggg
cagtgccgctcgtccAACTACCTGCGCATTCAGGCGAAACGGGAGAGCATGCCGCCGTGC
GGGCCGGACGGGGAGTACGACCCAACCCCGGCGAACGTGCACGCGCTGCTCGCGGCGGCG
GACGAGATGCTGAAGCACCGGAACGTGGAGTCGGTGCTGTTCGAAGGGAGGCGTGTCGGC
GAGCAGACGAACGCGGAGAGGCTGGACTGCTTcgccgccgagctcgtcgccgagcatcgc
agcaggggctcccgtattggccccaccgtggcgttcaagcaggcgccgcggaagcagccg
ccggcggcggcggtggcggcgatgggctga

Protein

470 aa

>Os03t0254400-01 Patatin-related phospholipase A, Modulation of longitudinal growth of vegetative tissues and seeds
MEEAEEMQVERMQEEVEGGGADTDKLSYEIFSILESKFLFGYTDPHQLWLPKAPAAQASA
ATAVPSGKAAQRGKVCVLCVDGGGGGLRALLSGRALAHLEAALRRASGDPDARVADYFDL
VAGTGAGGVFAAMLFSTHSRGAPLFHADDTWRLVADHAPRLFRKAVGGSTSLFCRPKKRP
LAAPTAALDAAMKTAFGEELTLRDTIKPVLISCYDLKSSAPLVFSRADALESESYDFRLC
EVGRAAWSEAGRFEPAEVASVDGATSCAAVDGGPIMGSPAAAAITHVLHNKHEFPFVRGV
EDLLVLSIGGCSAGGTGAAADADLRRLRRWGPKDWARPIARIAADGAADLVDHAVARAFG
QCRSSNYLRIQAKRESMPPCGPDGEYDPTPANVHALLAAADEMLKHRNVESVLFEGRRVG
EQTNAERLDCFAAELVAEHRSRGSRIGPTVAFKQAPRKQPPAAAVAAMG*

5'UTR

chr03:8152539..8152977 (+ strand) : 439 bp

CDS

chr03:8152978..8154090 (+ strand) : 1113 bp

chr03:8154176..8154472 (+ strand) : 297 bp

3'UTR

chr03:8154473..8154731 (+ strand) : 259 bp

FASTA

>Os03t0254400-01 class=Sequence position=chr03:8152539..8154731 (+ strand)
CAAAGGAGAG AGAGAGAGAG AGAGGAAGAC GACGACGACC TTTGTTGTTG TTTCCTTCTT TCTCTTCTCT TCTCCTCATC
CTCCTCTTTA GCTTCCTCTC GCGCTCGCCG TCTCTCTCTC TCTCTCTCTA TCGGGCGCGC GCCTTTCTGT GTTGGTCGTC
TCTTTCCTCG CGTGCTCTGC CGCTGCGCAA GAATCAAAAG GCGCCGGCCA CTAGAGAGAG TGTGTGTTTG TGTGTGTGTG
GCTTGAGTTG AGAGTTGAGA GACCAATCGA CCATCGGCTG TGATCTCAAA AGAGAGAGAG GGGCAAAGCG AAGTGGGCAG
ACTTGGGCGG CAATCCTTGC GAATCATCAA GGGATTCTGT CTTTTCTTTG GTGCGATTCG ATTGTTTCTT TGTAGGGGGA
AGGGAGAGAG GAGGGGGGGG GGGGGTTTTG GCAATTGGCA TGGAGGAGGC GGAGGAGATG CAGGTGGAGA GGATGCAGGA
GGAGGTGGAG GGAGGCGGCG CGGATACGGA TAAGCTCAGC TACGAGATTT TCTCCATCCT CGAGAGCAAG TTCCTGTTCG
GGTACACGGA CCCGCACCAG CTGTGGCTGC CCAAGGCGCC GGCGGCGCAG GCGTCGGCGG CGACGGCCGT GCCGTCGGGG
AAGGCGGCGC AGCGTGGGAA GGTGTGCGTG CTGTGCGTGG ATGGCGGCGG CGGCGGGCTG CGGGCGCTGC TCTCCGGCCg
cgcgctggcg cacctggagg ccgcgctccg gcgcgcgtcg ggcgacccgg acgcccgcgt cgcggactac ttcgacctcg
tcgccggtac gggcgccggc ggcgtgttcg ccgcgatgct gttctcgacg cactcgcgcg gcgcgcctct gttccacgcc
gatgacacat ggcgcctcgt ggctgaccac gctccccggc tcttccgcaa ggccgtcggc ggctcgacgt cgctcttctg
ccgacccaag aagcggcccc tcgcggcgcc gacggcggcg ctggacgcgg ccatgaagac ggcgttcggc gaggagctcA
CCCTGCGGGA TACCATCAAG CCCGTGCTCA TCTCCTGCTA CGACCTCAAG TCGTCCGCGC CGCTCGTGTT CTCGCGCGCC
GACGCCCTgg agagcgagag ctacgacttc cgcctctgcg aggtcggccg cgcggcgtgg tcggaggccg gccgattcga
gcccgccgag gtcgcgtcgg tcgacggcgc cacgtcctgc gccgccgtgg acggcgggcc gatcatgggc agccccgccg
ccgccgcaat cacgcacgtg cttcacaaca agcacgagtt cccgttcgtg cgcggcgtcg aggacctcct CGTGCTCTCC
ATCGGGGGAT GCTCCGCCGG TGGCACGGGG Gccgcggccg acgccgacct ccgacgcttg cgccgctggg gtcccaagga
ttgggcgcgc cccatcgcgc gcatcgccgc cgacggcgcc gccgacctcg tcgaccacgc cgtggcgcgc gccttcgggc
agtgccgctc gtccAACTAC CTGCGCATTC AGGTGAGCAA ATTCTCCCAC TGCATTGCGC ATTTCGAACG AACGTTCCCT
CGGATTAACC CTGGTACAAA TTCTCCGCCA TGATCAGGCG AAACGGGAGA GCATGCCGCC GTGCGGGCCG GACGGGGAGT
ACGACCCAAC CCCGGCGAAC GTGCACGCGC TGCTCGCGGC GGCGGACGAG ATGCTGAAGC ACCGGAACGT GGAGTCGGTG
CTGTTCGAAG GGAGGCGTGT CGGCGAGCAG ACGAACGCGG AGAGGCTGGA CTGCTTcgcc gccgagctcg tcgccgagca
tcgcagcagg ggctcccgta ttggccccac cgtggcgttc aagcaggcgc cgcggaagca gccgccggcg gcggcggtgg
cggcgatggg ctgagccggt ggccgcgtgc acTGTGGAGT AAGGACATGT AGGCCCTCTC TTTCTTCTTG CTTTCGCTGG
AATCCTGCTG CATTTTTTAC GTGGCAGAGT GGCATTGCTC CAAGAAGCAT TTTGCCAATG GGAAATTCGA CTTGGAGAAA
ATATGAAAGA ACATCTGTGA TATATAATTT CAGCTTCATT TCAATTTAGC ATAGAATTGT ACTAGTATCA TCTTTCTTCA
GAATCATATG CTTCTTTGTT TTCTCTTCAC ATA